Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

SSX4B antibody - middle region (ARP50423_P050)

100 ul
In Stock

Conjugation Options

ARP50423_P050-FITC Conjugated

ARP50423_P050-HRP Conjugated

ARP50423_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Synovial sarcoma, X breakpoint 4B
Protein Name:
Protein SSX4
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
SSX4, CT5.4
Replacement Item:
This antibody may replace item sc-137073 from Santa Cruz Biotechnology.
Description of Target:
The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X;18) translocation characteristically found in all synovial sarcomas. This translocation results in the fusion of the synovial sarcoma translocation gene on chromosome 18 to one of the SSX genes on chromosome X. Chromosome Xp11 contains a segmental duplication resulting in two identical copies of synovial sarcoma, X breakpoint 4, SSX4 and SSX4B, in tail-to-tail orientation. This gene, SSX4B, represents the more centromeric copy. Two transcript variants encoding distinct isoforms have been identified for this gene.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SSX4B.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SSX4B.
The immunogen is a synthetic peptide directed towards the middle region of human SSX4B
Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-SSX4B (ARP50423_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MRSKRAADFHGNDFGNDRNHRNQVERPQMTFGSLQRIFPKIMPKKPAEEE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-SSX4B (ARP50423_P050) antibody is Catalog # AAP50423 (Previous Catalog # AAPY02802)
Printable datasheet for anti-SSX4B (ARP50423_P050) antibody

Tell us what you think about this item!

Write A Review
    Please, wait...