SSTR4 Antibody - middle region (ARP33359_T100)

Catalog No: ARP33359_T100

WB Suggested Anti-SSTR4 Antibody
Titration: 1.25 ug/ml
Positive Control: Jurkat Whole Cell

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Mouse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SSTR4
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Mouse: 85%; Rabbit: 78%
• Peptide Sequence: Synthetic peptide located within the following region: AKLINLGVWLASLLVTLPIAIFADTRPARGGQAVACNLQWPHPAWSAVFV
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-SSTR4 (ARP33359_T100) antibody is Catalog # AAP33359
• Reference: Pasquali,D., et al., (2002) J. Clin. Endocrinol. Metab. 87 (11), 5125-5129

Target Info

• Gene Symbol: SSTR4
• Gene Full Name: Somatostatin receptor 4
• Alias Symbols: SS4R, SS4-R, SS-4-R
• NCBI Gene Id: 6754
• Protein Name: Somatostatin receptor type 4
• Description of Target: Somatostatin acts at many sites to inhibit the release of many hormones and other secretory proteins. The biologic effects of somatostatin are probably mediated by a family of G protein-coupled receptors that are expressed in a tissue-specific manner. SSTR4 is a member of the superfamily of receptors having seven transmembrane segments and is expressed in highest levels in fetal and adult brain and lung.
• Uniprot ID: P31391
• Protein Accession #: NP_001043
• Nucleotide Accession #: NM_001052
• Protein Size (# AA): 388
• Molecular Weight: 42kDa
• Protein Interactions: SST; CORT;