SSO7D Recombinant Protein (Sulfolobus solfataricus) (OPCA02897)

Catalog No: OPCA02897

sso7d Recombinant Protein (Sulfolobus solfataricus) (OPCA02897) in SDS-PAGE showing the molecular weight of approximately 9.1 kDa.

Product Info

• Predicted Species Reactivity: Sulfolobus solfataricus
• Product Format: Liquid or Lyophilized powder
• Host: Sulfolobus solfataricus
• Additional Information: Relevance: Constrain negative DNA supercoils; may be involved in maintaining the integrity of their genome at high tperature. Stimulates the Holliday junction cleavage activity of Hjc.
• Reconstitution and Storage: -20°C or -80°C
• Formulation: 20 mM Tris-HCl based buffer, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: ATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKK
• Protein Sequence: ATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKK
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Yeast
• Protein Range: 2-64 aa
• Tag: N-terminal 6xHis-tagged

Target Info

• Reference: The complete genome of the crenarchaeon Sulfolobus solfataricus P2.She Q., Singh R.K., Confalonieri F., Zivanovic Y., Allard G., Awayez M.J., Chan-Weiher C.C.-Y., Clausen I.G., Curtis B.A., De Moors A., Erauso G., Fletcher C., Gordon P.M.K., Heikamp-de Jong I., Jeffries A.C., Kozera C.J., Medina N., Peng X. , Thi-Ngoc H.P., Redder P., Schenk M.E., Theriault C., Tolstrup N., Charlebois R.L., Doolittle W.F., Duguet M., Gaasterland T., Garrett R.A., Ragan M.A., Sensen C.W., Van der Oost J.Proc. Natl. Acad. Sci. U.S.A. 98:7835-7840(2001)
• Gene Symbol: SSO7D
• Alias Symbols: 7 kDa DNA-binding protein d;Sso7d.
• NCBI Gene Id: 25402805
• Protein Name: DNA-binding protein 7d
• Description of Target: Can constrain negative DNA supercoils. May be involved in maintaining the integrity of the genome at high temperature (By similarity). Stimulates the Holliday junction cleavage activity of Hjc (PubMed:11709558).
• Uniprot ID: P39476
• Protein Accession #: WP_009990119.1
  
• Nucleotide Accession #: NC_002754.1
• Protein Size (# AA): Recombinant
• Molecular Weight: 9.1 kDa