SSO7D Recombinant Protein (Sulfolobus solfataricus) (OPCA02060)

Catalog No: OPCA02060

sso7d Recombinant Protein (Sulfolobus solfataricus) (OPCA02060) in SDS-PAGE showing the molecular weight of approximately 23.1 kDa.

Product Info

• Predicted Species Reactivity: Sulfolobus solfataricus
• Product Format: Lyophilized 20mM Tris-HCl, 0.5M NaCl, 6% Trehalose
• Host: Sulfolobus solfataricus
• Reconstitution and Storage: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Purification: Affinity purified using IMAC
• Purity: Greater than 90% as determined by SDS-PAGE.
• Protein Sequence: Full Length of Mature Protein: ATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKK
• Source: E.coli
• Tag: N-terminal 6xHis-SUMO-tagged

Target Info

• Reference: The complete genome of the crenarchaeon Sulfolobus solfataricus P2.She Q., Singh R.K., Confalonieri F., Zivanovic Y., Allard G., Awayez M.J., Chan-Weiher C.C.-Y., Clausen I.G., Curtis B.A., De Moors A., Erauso G., Fletcher C., Gordon P.M.K., Heikamp-de Jong I., Jeffries A.C., Kozera C.J., Medina N., Peng X. , Thi-Ngoc H.P., Redder P., Schenk M.E., Theriault C., Tolstrup N., Charlebois R.L., Doolittle W.F., Duguet M., Gaasterland T., Garrett R.A., Ragan M.A., Sensen C.W., Van der Oost J.Proc. Natl. Acad. Sci. U.S.A. 98:7835-7840(2001)
• Gene Symbol: SSO7D
• Alias Symbols: 7 kDa DNA-binding protein d;Sso7d.
• NCBI Gene Id: 25402805
• Protein Name: DNA-binding protein 7d
• Description of Target: Can constrain negative DNA supercoils. May be involved in maintaining the integrity of the genome at high temperature (By similarity). Stimulates the Holliday junction cleavage activity of Hjc (PubMed:11709558).
• Uniprot ID: P39476
• Protein Accession #: WP_009990119.1
  
• Nucleotide Accession #: NC_002754.1
• Protein Size (# AA): 2-64
• Molecular Weight: 23.1 kDa