SSB Antibody (Phospho-Ser366) (OAAF07645)

Catalog No: OAAF07645 (Formerly GWB-ASB559)

Size:100 ug

Western blot analysis of lysates from 293 cells, using SSB (Phospho-Ser366) Antibody. The lane on the right is blocked with the phospho peptide.

Immunohistochemistry analysis of paraffin-embedded human breast carcinoma, using SSB (Phospho-Ser366) Antibody. The picture on the right is blocked with the phospho peptide.

Immunofluorescence analysis of HeLa cells treated with Forskolin 40nM 30', using SSB (Phospho-Ser366) Antibody. The picture on the right is blocked with the phospho peptide.

Product Info

• Predicted Species Reactivity: Human|Mouse|Rat
• Clonality: Polyclonal
• Host: Rabbit
• Application: Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot
• Additional Information: Modification Sites: Human:S366
• Reconstitution and Storage: -20°C
• Immunogen: The antiserum was produced against synthesized peptide derived from human SSB around the phosphorylation site of Ser366.
• Purification: The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
• Peptide Sequence: Synthetic peptide located within the following region: KGNKAAQPGSGKGKVQFQGKKTKFASDDEHDEHDENGATGPVKRAREETD
• Concentration: 1mg/ml
• Specificity: SSB (Phospho-Ser366) Antibody detects endogenous levels of SSB only when phosphorylated at Ser366.
• Formulation: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
• Application Info: WB: 1:500~1:1000
  IHC: 1:50~1:100
  IF: 1:100~1:500
  ELISA: 1:40000

Target Info

• Gene Symbol: SSB
• Gene Full Name: small RNA binding exonuclease protection factor La
• Alias Symbols: autoantigen La;La;la autoantigen;La ribonucleoprotein;La ribonucleoprotein domain family, member 3;La/SSB;LARP3;lupus La antigen;lupus La protein;sjoegren syndrome type B antigen;Sjogren syndrome antigen B;SS-B;SS-B/La protein.
• NCBI Gene Id: 6741
• Protein Name: Lupus La protein
• Description of Target: Binds to the 3' poly(U) terminus of nascent RNA polymerase III transcripts, protecting them from exonuclease digestion and facilitating their folding and maturation (PubMed:3192525, PubMed:2470590). In case of Coxsackievirus B3 infection, binds to the viral internal ribosome entry site (IRES) and stimulates the IRES-mediated translation (PubMed:12384597).
• Uniprot ID: P05455
• Molecular Weight: 46 kDa