Protein on Demand™ SRPX2 Recombinant Protein (Human) (OPCA33783)

Datasheets/Manuals	Printable datasheet for OPCA33783

Product Info
Predicted Species Reactivity	Human
Product Format	Liquid
Application	WB, ELISA
Additional Information	For Research Use Only. Sterile filtering available upon request. Low endotoxin available upon request.
Reconstitution and Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Purity	Greater than 85% as determined by SDS-PAGE.
Protein Sequence	TWYAGSGYYPDESYNEVYAEEVPQAPALDYRVPRWCYTLNIQDGEATCYSPKGGNYHSSLGTRCELSCDRGFRLIGRRSVQCLPSRRWSGTAYCRQMRCHALPFITSGTYTCTNGVLLDSRCDYSCSSGYHLEGDRSRICMEDGRWSGGEPVCVDIDPPKIRCPHSREKMAEPEKLTARVYWDPPLVKDSADGTITRVTLRGPEPGSHFPEGEHVIRYTAYDRAYNRASCKFIVKVQVRRCPTLKPPQHGYLTCTSAGDNYGATCEYHCDGGYDRQGTPSRVCQSSRQWSGSPPICAPMKINVNVNSAAGLLDQFYEKQRLLIISAPDPSNRYYKMQISMLQQSTCGLDLRHVTIIELVGQPPQEVGRIREQQLSANIIEELRQFQRLTRSYFNMVLIDKQGIDRDRYMEPVTPEEIFTFIDDYLLSNQELTQRREQRDICE
Storage Buffer	Tris-based buffer,50% glycerol
Protein Range	24-465

Gene Full Name	sushi repeat containing protein X-linked 2
Alias Symbols	BPP, CBPS, PMGX, RESDX, SRPUL
NCBI Gene Id	27286
Protein Name	sushi repeat-containing protein SRPX2
Description of Target	This gene encodes a secreted protein that contains three sushi repeat motifs. The encoded protein may play a role in the development of speech and language centers in the brain. This protein may also be involved in angiogenesis. Mutations in this gene are
Uniprot ID	O60687
Protein Accession #	NP_055282.1
Nucleotide Accession #	NM_014467.2
Protein Size (# AA)	442