Search Antibody, Protein, and ELISA Kit Solutions

SRPRB Antibody - middle region (ARP49643_P050)

100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP49643_P050-FITC Conjugated

ARP49643_P050-HRP Conjugated

ARP49643_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
IHC, WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-100169 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human SRPRB
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-SRPRB (ARP49643_P050)
Peptide Sequence:
Synthetic peptide located within the following region: QDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLYSSSTAPAQLGKKGKE
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-SRPRB (ARP49643_P050) antibody is Catalog # AAP49643 (Previous Catalog # AAPY02721)
Datasheets/Manuals:
Printable datasheet for anti-SRPRB (ARP49643_P050) antibody
Sample Type Confirmation:

SRPRB is supported by BioGPS gene expression data to be expressed in 721_B, HeLa, Jurkat

Subunit:
beta
Target Reference:
Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)
Gene Symbol:
SRPRB
Official Gene Full Name:
Signal recognition particle receptor, B subunit
Alias Symbols:
APMCF1
NCBI Gene Id:
58477
Protein Name:
Signal recognition particle receptor subunit beta
Description of Target:
SRPRB has similarity to mouse protein which is a subunit of the signal recognition particle receptor (SR). This subunit is a transmembrane GTPase belonging to the GTPase superfamily. It anchors alpha subunit, a peripheral membrane GTPase, to the ER membrane. SR is required for the cotranslational targeting of both secretory and membrane proteins to the ER membrane.The protein encoded by this gene has similarity to mouse protein which is a subunit of the signal recognition particle receptor (SR). This subunit is a transmembrane GTPase belonging to the GTPase superfamily. It anchors alpha subunit, a peripheral membrane GTPase, to the ER membrane. SR is required for the cotranslational targeting of both secretory and membrane proteins to the ER membrane.The protein encoded by this gene has similarity to mouse protein which is a subunit of the signal recognition particle receptor (SR). This subunit is a transmembrane GTPase belonging to the GTPase superfamily. It anchors alpha subunit, a peripheral membrane GTPase, to the ER membrane. SR is required for the cotranslational targeting of both secretory and membrane proteins to the ER membrane.
Swissprot Id:
Q9Y5M8
Protein Accession #:
NP_067026
Nucleotide Accession #:
NM_021203
Protein Size (# AA):
271
Molecular Weight:
30kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SRPRB.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SRPRB.
Protein Interactions:
ERLIN2; UBC; STAU1; MDM2; FBXO6; PPP6R1; ADRB2; LMNA; UBL4A; CA9; UBE2L3; TAGLN; SPR; SNRPC; S100A10; RRBP1; RPL38; RFX5; RBMS1; PIN4; PFN1; ACAA1; TMED4; TMEM65; RPS10P5; MRRF; SARNP; NABP2; MRPL14; TMBIM1; SUGP1; SBDS; MRPS28; TARDBP; TOMM40; UBE4B; SF3

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...