Search Antibody, Protein, and ELISA Kit Solutions

SRPRB Antibody - middle region (ARP49643_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP49643_P050-FITC Conjugated

ARP49643_P050-HRP Conjugated

ARP49643_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Signal recognition particle receptor, B subunit
NCBI Gene Id:
Protein Name:
Signal recognition particle receptor subunit beta
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-100169 from Santa Cruz Biotechnology.
Description of Target:
SRPRB has similarity to mouse protein which is a subunit of the signal recognition particle receptor (SR). This subunit is a transmembrane GTPase belonging to the GTPase superfamily. It anchors alpha subunit, a peripheral membrane GTPase, to the ER membrane. SR is required for the cotranslational targeting of both secretory and membrane proteins to the ER membrane.The protein encoded by this gene has similarity to mouse protein which is a subunit of the signal recognition particle receptor (SR). This subunit is a transmembrane GTPase belonging to the GTPase superfamily. It anchors alpha subunit, a peripheral membrane GTPase, to the ER membrane. SR is required for the cotranslational targeting of both secretory and membrane proteins to the ER membrane.The protein encoded by this gene has similarity to mouse protein which is a subunit of the signal recognition particle receptor (SR). This subunit is a transmembrane GTPase belonging to the GTPase superfamily. It anchors alpha subunit, a peripheral membrane GTPase, to the ER membrane. SR is required for the cotranslational targeting of both secretory and membrane proteins to the ER membrane.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SRPRB.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SRPRB.
The immunogen is a synthetic peptide directed towards the middle region of human SRPRB
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-SRPRB (ARP49643_P050)
Peptide Sequence:
Synthetic peptide located within the following region: QDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLYSSSTAPAQLGKKGKE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-SRPRB (ARP49643_P050) antibody is Catalog # AAP49643 (Previous Catalog # AAPY02721)
Printable datasheet for anti-SRPRB (ARP49643_P050) antibody
Sample Type Confirmation:

SRPRB is supported by BioGPS gene expression data to be expressed in 721_B, HeLa, Jurkat

Target Reference:
Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...