SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: AVARP09038_P050
Price: $0.00
SKU
AVARP09038_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-SRP72 (AVARP09038_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SRP72
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 80%
Peptide SequenceSynthetic peptide located within the following region: GDSQPKEQGQGDLKKKKKKKKGKLPKNYDPKVTPDPERWLPMRERSYYRG
Concentration0.5 mg/ml
Blocking PeptideFor anti-SRP72 (AVARP09038_P050) antibody is Catalog # AAP30615 (Previous Catalog # AAPP01268)
Sample Type Confirmation

There is BioGPS gene expression data showing that SRP72 is expressed in PANC1

ReferenceIakhiaeva,E., (2008) RNA 14 (6), 1143-1153
Gene SymbolSRP72
Gene Full NameSignal recognition particle 72kDa
Alias SymbolsBMFF, BMFS1, HEL103
NCBI Gene Id6731
Protein NameSignal recognition particle 72 kDa protein
Description of TargetSignal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP72 binds the 7S RNA only in presence of SRP68. This ribonucleoprotein complex might interact directly with the docking protein in the ER membrane and possibly participate in the elongation arrest function.
Uniprot IDO76094
Protein Accession #NP_008878
Nucleotide Accession #NM_006947
Protein Size (# AA)671
Molecular Weight74kDa
Protein InteractionsSTAU1; LIN28A; TARBP2; RNF2; KIF21A; MLF2; SOX2; METTL18; UBC; SKIL; SRP68; CAND1; CUL3; SIRT7; FCHSD2; HDGF; MEPCE; RPAP1; HNRNPA1; CASP6; CASP3;
  1. What is the species homology for "SRP72 Antibody - middle region (AVARP09038_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish".

  2. How long will it take to receive "SRP72 Antibody - middle region (AVARP09038_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SRP72 Antibody - middle region (AVARP09038_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SRP72 Antibody - middle region (AVARP09038_P050)"?

    This target may also be called "BMFF, BMFS1, HEL103" in publications.

  5. What is the shipping cost for "SRP72 Antibody - middle region (AVARP09038_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SRP72 Antibody - middle region (AVARP09038_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SRP72 Antibody - middle region (AVARP09038_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "74kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SRP72 Antibody - middle region (AVARP09038_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SRP72"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SRP72"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SRP72"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SRP72"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SRP72"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SRP72"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SRP72 Antibody - middle region (AVARP09038_P050)
Your Rating
We found other products you might like!