SRP68 Antibody - N-terminal region (ARP40757_P050)

Catalog No: ARP40757_P050

WB Suggested Anti-SRP68 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SRP68
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 77%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
• Peptide Sequence: Synthetic peptide located within the following region: EENKENERPSAGSKANKEFGDSLSLEILQIIKESQQQHGLRHGDFQRYRG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SRP68 (ARP40757_P050) antibody is Catalog # AAP40757 (Previous Catalog # AAPY01009)
• Reference: Iakhiaeva,E., (2006) Protein Sci. 15 (6), 1290-1302

Target Info

• Gene Symbol: SRP68
• Gene Full Name: Signal recognition particle 68kDa
• Alias Symbols: -
• NCBI Gene Id: 6730
• Protein Name: Signal recognition particle 68 kDa protein
• Description of Target: The signal recognition particle (SRP) is a ribonucleoprotein complex that transports secreted and membrane proteins to the endoplasmic reticulum for processing. The complex includes a 7S RNA and six protein subunits. SRP68 is the 68kDa component of the SRP.The signal recognition particle (SRP) is a ribonucleoprotein complex that transports secreted and membrane proteins to the endoplasmic reticulum for processing. The complex includes a 7S RNA and six protein subunits. This gene encodes the 68kDa component of the SRP. Alternatively spliced transcript variants have been identified, but their biological validity has not been determined. Three related pseudogenes are located within the Smith-Magenis syndrome region on chromosome 17.
• Uniprot ID: Q9UHB9
• Protein Accession #: NP_055045
• Nucleotide Accession #: NM_014230
• Protein Size (# AA): 627
• Molecular Weight: 71kDa
• Protein Interactions: SUMO2; SUMO3; STAU1; UBC; RNF2; KIF21A; KDM3B; ELP4; NCS1; SOX2; METTL18; SRP54; SRP9; SMN1; KIF5B; SRP72; UBD; CAND1; CUL3; SIRT7; HDGF; RNF185; MEPCE; USP7;