Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: ARP65277_P050
Price: $0.00
SKU
ARP65277_P050
Availability: Domestic: within 24 hours delivery | International: 3-5 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

SRGAP2 Antibody - N-terminal region (ARP65277_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-SRGAP2 (ARP65277_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SRGAP2
PurificationAffinity purified
Predicted Homology Based on Immunogen SequenceCow: 87%; Dog: 100%; Guinea Pig: 87%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 87%
Peptide SequenceSynthetic peptide located within the following region: AERFLAKTCSTKDQQFKKDQNVLSPVNCWNLLLNQVKRESRDHTTLSDIY
Concentration0.5 mg/ml
Blocking PeptideFor anti-SRGAP2 (ARP65277_P050) antibody is Catalog # AAP65277
Gene SymbolSRGAP2
Gene Full NameSLIT-ROBO Rho GTPase activating protein 2
Alias SymbolsFNBP2, SRGAP3, SRGAP2A, ARHGAP34
NCBI Gene Id23380
Protein NameSLIT-ROBO Rho GTPase-activating protein 2
Description of TargetThis locus encodes a member of the SLIT-ROBO Rho GTPase activating protein family. The encoded protein stimulates GTPase activity of Rac1, and plays a role in cortical neuron development. This locus has several paralogs on human chromosome 1 resulting from segmental duplication. While this locus itself is conserved among various species, the paralogs are found only in the genus Homo, and not in the genomes of non-human great apes. Alternatively spliced transcript variants have been described for this locus.
Uniprot IDP0DJJ0
Protein Accession #NP_001258799
Nucleotide Accession #NM_001170637.3
Protein Size (# AA)459
Molecular Weight53 kDa
Protein InteractionsUBC; PPP2R1A; YWHAB; YWHAE; UBD; FASLG; HERC2; EXOC1; DISC1; YWHAG; MYO1G; YLPM1; ATAD3A; ITSN2; SLC25A12; WIPF1; WAS; DIAPH1; ROBO1;
  1. What is the species homology for "SRGAP2 Antibody - N-terminal region (ARP65277_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "SRGAP2 Antibody - N-terminal region (ARP65277_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 days".

  3. What buffer format is "SRGAP2 Antibody - N-terminal region (ARP65277_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SRGAP2 Antibody - N-terminal region (ARP65277_P050)"?

    This target may also be called "FNBP2, SRGAP3, SRGAP2A, ARHGAP34" in publications.

  5. What is the shipping cost for "SRGAP2 Antibody - N-terminal region (ARP65277_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SRGAP2 Antibody - N-terminal region (ARP65277_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SRGAP2 Antibody - N-terminal region (ARP65277_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "53 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SRGAP2 Antibody - N-terminal region (ARP65277_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SRGAP2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SRGAP2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SRGAP2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SRGAP2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SRGAP2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SRGAP2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SRGAP2 Antibody - N-terminal region (ARP65277_P050)
Your Rating
We found other products you might like!