Search Antibody, Protein, and ELISA Kit Solutions

Srgap1 Antibody - middle region : FITC (ARP57446_P050-FITC)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP57446_P050 Unconjugated

ARP57446_P050-HRP Conjugated

ARP57446_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
SLIT-ROBO Rho GTPase activating protein 1
NCBI Gene Id:
Protein Name:
SLIT-ROBO Rho GTPase-activating protein 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Arhgap13, 4930572H05Rik, Srgap1
Replacement Item:
This antibody may replace item sc-153820 from Santa Cruz Biotechnology.
Description of Target:
The function remains unknown.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Srgap1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Srgap1.
The immunogen is a synthetic peptide corresponding to a region of Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-Srgap1 (ARP57446_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DAKELDGPVYEKCMAGGDYCDSPYSEHGTLEEVDQDAGTEPHTSEDECRG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
1 mg/ml
Protein Interactions:
Robo1; Cdc42; Rhoa; BMPR1B;
Blocking Peptide:
For anti-Srgap1 (ARP57446_P050-FITC) antibody is Catalog # AAP57446 (Previous Catalog # AAPP41440)
Printable datasheet for anti-Srgap1 (ARP57446_P050-FITC) antibody
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...