Search Antibody, Protein, and ELISA Kit Solutions

SRD5A2 Antibody - N-terminal region : FITC (ARP44264_P050-FITC)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP44264_P050 Unconjugated

ARP44264_P050-HRP Conjugated

ARP44264_P050-Biotin Conjugated

Gene Symbol:
SRD5A2
Official Gene Full Name:
Steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2)
NCBI Gene Id:
6716
Protein Name:
3-oxo-5-alpha-steroid 4-dehydrogenase 2
Swissprot Id:
Q28892
Protein Accession #:
NP_000339
Nucleotide Accession #:
NM_000348
Alias Symbols:
MGC138457
Replacement Item:
This antibody may replace item sc-20400 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result
Protein Size (# AA):
254
Molecular Weight:
28kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SRD5A2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SRD5A2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human SRD5A2
Predicted Species Reactivity:
Human, Pig, Rabbit
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Pig: 86%; Rabbit: 91%
Complete computational species homology data:
Anti-SRD5A2 (ARP44264_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.5 mg/ml
Blocking Peptide:
For anti-SRD5A2 (ARP44264_P050-FITC) antibody is Catalog # AAP44264 (Previous Catalog # AAPP25644)
Datasheets/Manuals:
Printable datasheet for anti-SRD5A2 (ARP44264_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...