Search Antibody, Protein, and ELISA Kit Solutions

SRD5A1 Antibody - middle region (ARP84362_P050)

100 ul
In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Predicted Species Reactivity:
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
steroid 5 alpha-reductase 1
NCBI Gene Id:
Protein Name:
3-oxo-5-alpha-steroid 4-dehydrogenase 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
S5AR 1
Description of Target:
Steroid 5-alpha-reductase catalyzes the conversion of testosterone into the more potent androgen, dihydrotestosterone (DHT). Also see SRD5A2.
Protein Size (# AA):
Molecular Weight:
29 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SRD5A1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SRD5A1.
The immunogen is a synthetic peptide directed towards the middle region of human SRD5A1
Peptide Sequence:
Synthetic peptide located within the following region: GMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYFGEIMEWCGYA
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-SRD5A1 (ARP84362_P050) antibody is Catalog # AAP84362
Printable datasheet for anti-SRD5A1 (ARP84362_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...