Search Antibody, Protein, and ELISA Kit Solutions

SQLE Antibody - C-terminal region (ARP42101_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP42101_P050-FITC Conjugated

ARP42101_P050-HRP Conjugated

ARP42101_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Squalene epoxidase
NCBI Gene Id:
Protein Name:
Squalene monooxygenase
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-49754 from Santa Cruz Biotechnology.
Description of Target:
Squalene epoxidase catalyzes the first oxygenation step in sterol biosynthesis and is thought to be one of the rate-limiting enzymes in this pathway.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SQLE.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SQLE.
The immunogen is a synthetic peptide directed towards the C terminal region of human SQLE
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 93%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 93%; Sheep: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-SQLE (ARP42101_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KKSFYWARKTSHSFVVNILAQALYELFSATDDSLHQLRKACFLYFKLGGE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-SQLE (ARP42101_P050) antibody is Catalog # AAP42101 (Previous Catalog # AAPP24580)
Printable datasheet for anti-SQLE (ARP42101_P050) antibody
Sample Type Confirmation:

SQLE is strongly supported by BioGPS gene expression data to be expressed in 721_B

Additional Information:
IHC Information: 721_B cell lysate. Antibody concentration: 0.25 ug/ml. Gel concentration: 12%.

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...