SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP58532_P050
Price: $0.00
SKU
ARP58532_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-SPTAN1 (ARP58532_P050) antibody
Product Info
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, IP, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SPTAN1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQ
Concentration0.5 mg/ml
Blocking PeptideFor anti-SPTAN1 (ARP58532_P050) antibody is Catalog # AAP58532 (Previous Catalog # AAPP34842)
Sample Type Confirmation

SPTAN1 is strongly supported by BioGPS gene expression data to be expressed in HeLa

Enhanced Validation
WBY
SPR
YCHAROS
Other Applications Image 1 DataIP Suggested Anti-SPTAN1 antibody
Titration: 2 ug/ml
Positive Control: Mouse brain homogenate
ReferenceOlsen,J.V., (2006) Cell 127 (3), 635-648
Gene SymbolSPTAN1
Gene Full NameSpectrin, alpha, non-erythrocytic 1 (alpha-fodrin)
Alias SymbolsDEE5, NEAS, EIEE5, SPTA2
NCBI Gene Id6709
Protein NameSpectrin alpha chain, non-erythrocytic 1
Description of TargetFodrin (SPTAN1), which seems to be involved in secretion, interacts with calmodulin in a calcium-dependent manner and is thus candidate for the calcium-dependent movement of the cytoskeleton at the membrane.
Uniprot IDQ13813
Protein Accession #NP_003118
Nucleotide Accession #NM_003127
Protein Size (# AA)2472
Molecular Weight285 kDa
Protein InteractionsSUMO3; CEP57; VCP; CEP76; STAU1; UBC; MDM2; RPA3; RPA2; RPA1; ZBTB1; EHBP1L1; NUP188; GPHN; PPP4R1; PPFIA1; PLS1; FAU; CRYZ; RPS24; PTBP1; SAV1; MAPK9; CASP7; CASP3; UBD; CAPN1; PAN2; SVIL; Tes; UBL4A; MLH1; HSP90AB1; HSP90AA1; GRIN2B; GRIN2A; GRIN1; ESR1
  1. What is the species homology for "SPTAN1 Antibody - N-terminal region (ARP58532_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish".

  2. How long will it take to receive "SPTAN1 Antibody - N-terminal region (ARP58532_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SPTAN1 Antibody - N-terminal region (ARP58532_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SPTAN1 Antibody - N-terminal region (ARP58532_P050)"?

    This target may also be called "DEE5, NEAS, EIEE5, SPTA2" in publications.

  5. What is the shipping cost for "SPTAN1 Antibody - N-terminal region (ARP58532_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SPTAN1 Antibody - N-terminal region (ARP58532_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SPTAN1 Antibody - N-terminal region (ARP58532_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "285 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SPTAN1 Antibody - N-terminal region (ARP58532_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SPTAN1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SPTAN1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SPTAN1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SPTAN1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SPTAN1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SPTAN1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SPTAN1 Antibody - N-terminal region (ARP58532_P050)
Your Rating
We found other products you might like!