SPRR2A Recombinant Protein (Mouse) (OPCA03450)

Catalog No: OPCA03450

Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane

Sprr2a Recombinant Protein (Mouse) (OPCA03450) in SDS-PAGE showing the molecular weight of approximately 13.5 kDa.

Product Info

• Predicted Species Reactivity: Mouse|Mus musculus
• Product Format: Liquid or Lyophilized powder
• Host: Mouse
• Reconstitution and Storage: -20°C or -80°C
• Purification: Affinity purified using IMAC
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: MSYYQQQCNQPCRPPPVCPPPKCPEPCPPQVWPGPCRPVMCFEPCLPSVWPGPCRPVVCYEQCPPQPWQSTCPPVQFPPCQQK
• Protein Sequence: Full Length: MSYYQQQCNQPCRPPPVCPPPKCPEPCPPQVWPGPCRPVMCFEPCLPSVWPGPCRPVVCYEQCPPQPWQSTCPPVQFPPCQQK
• Source: E.coli
• Tag: N-terminal 6xHis-tagged

Target Info

• Reference: Mouse Sprr2 genes: a clustered family of genes showing differential expression in epithelial tissues.Song H.J., Poy G., Darwiche N., Lichti U., Kuroki T., Steinert P.M., Kartasova T.Genomics 55:28-42(1999)
• Gene Symbol: Sprr2a1|Sprr2a2|Sprr2a3
• Gene Full Name: small proline-rich protein 2A1|small proline-rich protein 2A2|small proline-rich protein 2A3
• Alias Symbols: S, small proline-rich protein 2A, Small proline-rich protein 2A1, small proline-rich protein 2A2, small proline-rich protein 2A3, Sprr2a, Sprr2a1, Sprr2a3.
• NCBI Gene Id: 100042514|100303744|20755
• Protein Name: Small proline-rich protein 2A1
• Description of Target: Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane (By similarity).
• Uniprot ID: Q9CQK8
• Protein Size (# AA): Full Length
• Molecular Weight: 13.4 kDa