Search Antibody, Protein, and ELISA Kit Solutions

SPRED2 Antibody - C-terminal region (ARP60369_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP60369_P050-FITC Conjugated

ARP60369_P050-HRP Conjugated

ARP60369_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-240921 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human SPRED2
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 92%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Complete computational species homology data:
Anti-SPRED2 (ARP60369_P050)
Peptide Sequence:
Synthetic peptide located within the following region: NHEENRRGHCQDAPDSVRTCIRRVSCMWCADSMLYHCMSDPEGDYTDPCS
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-SPRED2 (ARP60369_P050) antibody is Catalog # AAP60369 (Previous Catalog # AAPP46548)
Datasheets/Manuals:
Printable datasheet for anti-SPRED2 (ARP60369_P050) antibody
Sample Type Confirmation:

There is BioGPS gene expression data showing that SPRED2 is expressed in HepG2

Gene Symbol:
SPRED2
Official Gene Full Name:
Sprouty-related, EVH1 domain containing 2
Alias Symbols:
FLJ21897, FLJ31917, MGC163164, Spred-2
NCBI Gene Id:
200734
Protein Name:
Sprouty-related, EVH1 domain-containing protein 2
Description of Target:
SPRED2 is a member of the Sprouty /SPRED family of proteins that regulate growth factor-induced activation of the MAP kinase cascade .
Swissprot Id:
Q7Z698
Protein Accession #:
NP_861449
Nucleotide Accession #:
NM_181784
Protein Size (# AA):
418
Molecular Weight:
47kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SPRED2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SPRED2.
Protein Interactions:
SPG21; TOP3B; UBC; SQSTM1; NBR1; ELAVL1; RHOA; KIT; TESK1;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...