Catalog No: OOPA00058 (Formerly GWB-BSP074)
Size:2ug
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for OOPA00058 |
---|
Product Format | Sterile Filtered colorless solution. |
---|---|
Host | HEK293 cells. |
:: | Product Introduction: Osteopontin is a glycoprotein that was first identified in osteoblasts and is involved in bone remodeling, immune functions in fibroblasts, macrophages, and lymphocytes during inflammation and wound healing. SPP1 binds tightly to hydroxyapatite. SPP1 forms an integral part of the mineralized matrix. SPP1 is vital to cell-matrix interaction. Secreted Phosphoprotein-1 protects against cardiac ischemia-reperfusion injury via late preconditioning. Expression of both Ostepontin and CD44 in hepatocellular carcinoma is linked with advanced tumor stage and contributes to prognosis information. SPP1 is the most over-expressed gene in intrahepatic cholangiocarcinoma. Secreted Phosphoprotein-1 overexpression is related with interstitial lung diseases. Product Description: Osteopontin Human Recombinant is a single, glycosylated, polypeptide chain produced in HEK293 cells, is a full length protein (amino acids 17-314) fused with a polyhistidine tag at the C-terminus, having a total calculated molecular mass of 34.5kDa (The actual molecular mass may be approximately 60-65kDa in SDS-PAGE under reducing conditions due to glycosylation). Osteopontin is purified by proprietary chromatographic techniques. |
Reconstitution and Storage | Store at 4C if entire vial will be used within 2-4 weeks. Store, frozen at -20C for longer periods of time. Please avoid freeze thaw cycles. |
Purity | Greater than 90.0% as determined by SDS-PAGE. |
Peptide Sequence | IPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQKQN LLAPQNAVSSEETNDFKQETLPSKSNESHDHMDDMDD EDDDDHVDSQDSIDSNDSDDVDDTDDSHQSDESHHSD ESDELVTDFPTDLPATEVFTPVVPTVDTYDGRGDSVVY GLRSKSKKFRRPDIQYPDATDEDITSHMESEELNGAYK AIPVAQDLNAPSDWDSRGKDSYETSQLDDQSAETHSH KQSRLYKRKANDESNEHSDVIDSQELSKVSREFHSHEF HSHEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN HHHHHH. |
Formulation | Osteopontin is supplied in 50mM Tris, 300mM NaCl and 10% Glycerol, pH 7.5. |
Purification | Greater than 90.0% as determined by SDS-PAGE. |
Gene Symbol | SPP1 |
---|---|
Alias Symbols | Secreted Phosphoprotein-1, OPN, BNSP, BSPI, ETA-1, MGC110940, SPP-1, Osteopontin, Bone sialoprotein 1, Urinary stone protein, Nephropontin, Uropontin, SPP1. |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
Write Your Own Review
We found other products you might like!