SPINT1 Antibody - middle region : Biotin (ARP44803_P050-Biotin)

Catalog No: ARP44803_P050-Biotin

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: Biotin
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SPINT1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: PFSEHCARFTYGGCYGNKNNFEEEQQCLESCRGISKKDVFGLRREIPIPS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SPINT1 (ARP44803_P050-Biotin) antibody is Catalog # AAP44803 (Previous Catalog # AAPP12279)

Target Info

• Gene Symbol: SPINT1
• Gene Full Name: Serine peptidase inhibitor, Kunitz type 1
• Alias Symbols: HAI, HAI1, MANSC2
• NCBI Gene Id: 6692
• Protein Name: cDNA, FLJ95704, highly similar to Homo sapiens serine protease inhibitor, Kunitz type 1 (SPINT1), mRNA EMBL BAG37346.1
• Description of Target: The protein encoded by this gene is a member of the Kunitz family of serine protease inhibitors. The protein is a potent inhibitor specific for HGF activator and is thought to be involved in the regulation of the proteolytic activation of HGF in injured t
• Uniprot ID: B2RBU9
• Protein Accession #: NP_001027539
• Nucleotide Accession #: NM_001032367
• Protein Size (# AA): 513
• Molecular Weight: 53kDa
• Protein Interactions: FAM46A; UBQLN4; UBC; ST14; HGFAC;