Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP44803_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP44803_P050-FITC Conjugated

ARP44803_P050-HRP Conjugated

ARP44803_P050-Biotin Conjugated

SPINT1 Antibody - middle region (ARP44803_P050)

Catalog#: ARP44803_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-110417 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SPINT1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-SPINT1 (ARP44803_P050)
Peptide Sequence Synthetic peptide located within the following region: PFSEHCARFTYGGCYGNKNNFEEEQQCLESCRGISKKDVFGLRREIPIPS
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-SPINT1 (ARP44803_P050) antibody is Catalog # AAP44803 (Previous Catalog # AAPP12279)
Datasheets/Manuals Printable datasheet for anti-SPINT1 (ARP44803_P050) antibody
Gene Symbol SPINT1
Official Gene Full Name Serine peptidase inhibitor, Kunitz type 1
Alias Symbols HAI, HAI1, MANSC2
NCBI Gene Id 6692
Protein Name cDNA, FLJ95704, highly similar to Homo sapiens serine protease inhibitor, Kunitz type 1 (SPINT1), mRNA EMBL BAG37346.1
Description of Target The protein encoded by this gene is a member of the Kunitz family of serine protease inhibitors. The protein is a potent inhibitor specific for HGF activator and is thought to be involved in the regulation of the proteolytic activation of HGF in injured t
Swissprot Id B2RBU9
Protein Accession # NP_001027539
Nucleotide Accession # NM_001032367
Protein Size (# AA) 513
Molecular Weight 53kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express SPINT1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express SPINT1.
Protein Interactions FAM46A; UBQLN4; UBC; ST14; HGFAC;
Write Your Own Review
You're reviewing:SPINT1 Antibody - middle region (ARP44803_P050)
Your Rating