Catalog No: ARP90654_P050
Price: $0.00
SKU
ARP90654_P050
Availability: Domestic: within 24 hours delivery | International: 3-5 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-SPC25 (ARP90654_P050) antibody
Product Info
Predicted Species ReactivityMouse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of mouse SPC25
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: PYMFSMSINEAKEYEVYDSSPHLECLAEFQEKVRKTNNFSAFLANIRKAF
Concentration0.5 mg/ml
Blocking PeptideFor anti-SPC25 (ARP90654_P050) antibody is Catalog # AAP90654
Gene SymbolSPC25
Gene Full NameSPC25, NDC80 kinetochore complex component, homolog (S. cerevisiae)
Alias SymbolsSpbc, Spbc25, 2600017H08Rik, 2610205L13Rik
NCBI Gene Id66442
Protein Namekinetochore protein Spc25
Description of TargetThis gene encodes a component of the kinetochore-associated NDC80 protein complex, which is required for the mitotic spindle checkpoint and for microtubule-kinetochore attachment. During meiosis in mouse, the protein localizes to the germinal vesicle and then is associated with the chromosomes following germinal vesicle breakdown. Knockdown of this gene in oocytes results in precocious polar body extrusion, chromosome misalignment and aberrant spindle formation. Alternative splicing results in multiple transcript variants.
Uniprot IDQ3UA16-2
Protein Accession #NP_001186052.1
Nucleotide Accession #NM_001199123.2
Protein Size (# AA)178
Molecular Weight19 kDa
  1. What is the species homology for "SPC25 Antibody - C-terminal region (ARP90654_P050)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Mouse".

  2. How long will it take to receive "SPC25 Antibody - C-terminal region (ARP90654_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 days".

  3. What buffer format is "SPC25 Antibody - C-terminal region (ARP90654_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SPC25 Antibody - C-terminal region (ARP90654_P050)"?

    This target may also be called "Spbc, Spbc25, 2600017H08Rik, 2610205L13Rik" in publications.

  5. What is the shipping cost for "SPC25 Antibody - C-terminal region (ARP90654_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SPC25 Antibody - C-terminal region (ARP90654_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SPC25 Antibody - C-terminal region (ARP90654_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "19 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SPC25 Antibody - C-terminal region (ARP90654_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SPC25"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SPC25"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SPC25"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SPC25"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SPC25"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SPC25"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SPC25 Antibody - C-terminal region (ARP90654_P050)
Your Rating