Size:100 ul
$319.00
In Stock
SKU
ARP63168_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP63168_P050-FITC Conjugated

ARP63168_P050-HRP Conjugated

ARP63168_P050-Biotin Conjugated

SPARC Antibody - C-terminal region (ARP63168_P050)

Catalog#: ARP63168_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, IHC
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-13324 from Santa Cruz Biotechnology.
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 86%; Goat: 93%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 79%; Rabbit: 93%; Rat: 92%; Sheep: 93%; Zebrafish: 77%
Complete computational species homology data Anti-SPARC (ARP63168_P050)
Peptide Sequence Synthetic peptide located within the following region: LAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-SPARC (ARP63168_P050) antibody is Catalog # AAP63168
Datasheets/Manuals Printable datasheet for anti-SPARC (ARP63168_P050) antibody
Sample Type Confirmation

SPARC is strongly supported by BioGPS gene expression data to be expressed in PANC1

Publications

Boyineni, J; Tanpure, S; Gnanamony, M; Antony, R; Fernández, KS; Lin, J; Pinson, D; Gondi, CS; SPARC overexpression combined with radiation retards angiogenesis by suppressing VEGF-A via miR‑410 in human neuroblastoma cells. 49, 1394-406 (2016). WB, IHC, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 27498840

Gene Symbol SPARC
Official Gene Full Name Secreted protein, acidic, cysteine-rich (osteonectin)
Alias Symbols ON
NCBI Gene Id 6678
Protein Name SPARC
Description of Target Secreted protein acidic and rich in cysteine/osteonectin/BM40, or SPARC, is a matrix-associated protein that elicits changes in cell shape, inhibits cell-cycle progression, and influences the synthesis of extracellular matrix (ECM).
Swissprot Id P09486
Protein Accession # NP_003109
Nucleotide Accession # NM_003118
Protein Size (# AA) 303
Molecular Weight 35kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express SPARC.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express SPARC.
Protein Interactions UBQLN1; ZNF579; XRCC6; CTSK; VEGFA; TGM2; TGFB1; THBS1; SPARC; PDGFA; PLAT; PLG; HSPG2; SDC2; FN1; COL13A1; COL3A1; COL1A2; COL1A1; COL2A1; PDGFB; COL5A1;
  1. What is the species homology for "SPARC Antibody - C-terminal region (ARP63168_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish".

  2. How long will it take to receive "SPARC Antibody - C-terminal region (ARP63168_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SPARC Antibody - C-terminal region (ARP63168_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SPARC Antibody - C-terminal region (ARP63168_P050)"?

    This target may also be called "ON" in publications.

  5. What is the shipping cost for "SPARC Antibody - C-terminal region (ARP63168_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SPARC Antibody - C-terminal region (ARP63168_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SPARC Antibody - C-terminal region (ARP63168_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "35kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SPARC Antibody - C-terminal region (ARP63168_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "SPARC"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SPARC"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SPARC"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SPARC"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SPARC"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SPARC"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SPARC Antibody - C-terminal region (ARP63168_P050)
Your Rating
We found other products you might like!