Catalog No: ARP63168_P050
Price: $0.00
SKU
ARP63168_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-SPARC (ARP63168_P050) antibody
Product Info
Publications

SPARC overexpression combined with radiation retards angiogenesis by suppressing VEGF-A via miR‑410 in human neuroblastoma cells. Int. J. Oncol. 49, 1394-406 (2016). 27498840

More...

Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, IHC
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 86%; Goat: 93%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 79%; Rabbit: 93%; Rat: 92%; Sheep: 93%; Zebrafish: 77%
Peptide SequenceSynthetic peptide located within the following region: LAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDL
Concentration0.5 mg/ml
Blocking PeptideFor anti-SPARC (ARP63168_P050) antibody is Catalog # AAP63168
Sample Type Confirmation

SPARC is strongly supported by BioGPS gene expression data to be expressed in PANC1

Gene SymbolSPARC
Gene Full NameSecreted protein, acidic, cysteine-rich (osteonectin)
Alias SymbolsON, ONT, OI17, BM-40
NCBI Gene Id6678
Protein NameSPARC
Description of TargetSecreted protein acidic and rich in cysteine/osteonectin/BM40, or SPARC, is a matrix-associated protein that elicits changes in cell shape, inhibits cell-cycle progression, and influences the synthesis of extracellular matrix (ECM).
Uniprot IDP09486
Protein Accession #NP_003109
Nucleotide Accession #NM_003118
Protein Size (# AA)303
Molecular Weight35kDa
Protein InteractionsUBQLN1; ZNF579; XRCC6; CTSK; VEGFA; TGM2; TGFB1; THBS1; SPARC; PDGFA; PLAT; PLG; HSPG2; SDC2; FN1; COL13A1; COL3A1; COL1A2; COL1A1; COL2A1; PDGFB; COL5A1;
  1. What is the species homology for "SPARC Antibody - C-terminal region (ARP63168_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish".

  2. How long will it take to receive "SPARC Antibody - C-terminal region (ARP63168_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SPARC Antibody - C-terminal region (ARP63168_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SPARC Antibody - C-terminal region (ARP63168_P050)"?

    This target may also be called "ON, ONT, OI17, BM-40" in publications.

  5. What is the shipping cost for "SPARC Antibody - C-terminal region (ARP63168_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SPARC Antibody - C-terminal region (ARP63168_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SPARC Antibody - C-terminal region (ARP63168_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "35kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SPARC Antibody - C-terminal region (ARP63168_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SPARC"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SPARC"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SPARC"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SPARC"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SPARC"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SPARC"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SPARC Antibody - C-terminal region (ARP63168_P050)
Your Rating
We found other products you might like!