Search Antibody, Protein, and ELISA Kit Solutions

SPARC Antibody - C-terminal region (ARP63168_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP63168_P050-FITC Conjugated

ARP63168_P050-HRP Conjugated

ARP63168_P050-Biotin Conjugated

Tested Species Reactivity:
Human, Mouse
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB, IHC
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-13324 from Santa Cruz Biotechnology.
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 86%; Goat: 93%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 79%; Rabbit: 93%; Rat: 92%; Sheep: 93%; Zebrafish: 77%
Complete computational species homology data:
Anti-SPARC (ARP63168_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDL
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-SPARC (ARP63168_P050) antibody is Catalog # AAP63168
Datasheets/Manuals:
Printable datasheet for anti-SPARC (ARP63168_P050) antibody
Sample Type Confirmation:

SPARC is strongly supported by BioGPS gene expression data to be expressed in PANC1

Publications:

Boyineni, J; Tanpure, S; Gnanamony, M; Antony, R; Fernández, KS; Lin, J; Pinson, D; Gondi, CS; SPARC overexpression combined with radiation retards angiogenesis by suppressing VEGF-A via miR‑410 in human neuroblastoma cells. 49, 1394-406 (2016). WB, IHC, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 27498840

Gene Symbol:
SPARC
Official Gene Full Name:
Secreted protein, acidic, cysteine-rich (osteonectin)
Alias Symbols:
ON
NCBI Gene Id:
6678
Protein Name:
SPARC
Description of Target:
Secreted protein acidic and rich in cysteine/osteonectin/BM40, or SPARC, is a matrix-associated protein that elicits changes in cell shape, inhibits cell-cycle progression, and influences the synthesis of extracellular matrix (ECM).
Swissprot Id:
P09486
Protein Accession #:
NP_003109
Nucleotide Accession #:
NM_003118
Protein Size (# AA):
303
Molecular Weight:
35kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SPARC.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SPARC.
Protein Interactions:
UBQLN1; ZNF579; XRCC6; CTSK; VEGFA; TGM2; TGFB1; THBS1; SPARC; PDGFA; PLAT; PLG; HSPG2; SDC2; FN1; COL13A1; COL3A1; COL1A2; COL1A1; COL2A1; PDGFB; COL5A1;

Product Reviews

Average Rating:
1 review
5 star
1
4 star
0
3 star
0
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

360/12/2019 19:02
  • Overall Experience:
  • Quality:
Rayne Institute

 25ug of Cell lysate was used to run on gel.

Lung cancer cell line H1702.

Primary antibody dilution was 1:1000.

Secondary antibody dilution was 1:2000.

Primary a/b against SPARC from aviva has been used in concentration 1:1000 overnight at 4C. Membrane has washed twice with PBS-T for 5 minutes and incubated with secondary a/b for 2 hours at room temperature.

The antibody has worked great. I had a clear band next to the expected molecular weight.

0
0
Reply
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...