SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP55622_P050
Price: $0.00
SKU
ARP55622_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-SPAG8 (ARP55622_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SPAG8
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 79%; Dog: 93%; Human: 100%; Mouse: 100%; Pig: 86%; Rabbit: 93%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: PAPTKPHDYRQEQPETFWIQRAPQLPTWWPLPTQVPAAEDYLTWKEWGFT
Concentration0.5 mg/ml
Blocking PeptideFor anti-SPAG8 (ARP55622_P050) antibody is Catalog # AAP55622 (Previous Catalog # AAPP34247)
ReferenceCheng,G.Y., (2007) Asian J. Androl. 9 (1), 23-29
Gene SymbolSPAG8
Gene Full NameSperm associated antigen 8
Alias SymbolsSMP1, BS-84, CT142, HSD-1, SPAG3, CILD28, hSMP-1
NCBI Gene Id26206
Protein NameSperm-associated antigen 8
Description of TargetThe correlation of anti-sperm antibodies with cases of unexplained infertility implicates a role for these antibodies in blocking fertilization. Improved diagnosis and treatment of immunologic infertility, as well as identification of proteins for targeted contraception, are dependent on the identification and characterization of relevant sperm antigens. SPAG8 is recognized by sperm agglutinating antibodies from an infertile woman. This protein is localized in germ cells of the testis at all stages of spermatogenesis and is localized to the acrosomal region of mature spermatozoa.The correlation of anti-sperm antibodies with cases of unexplained infertility implicates a role for these antibodies in blocking fertilization. Improved diagnosis and treatment of immunologic infertility, as well as identification of proteins for targeted contraception, are dependent on the identification and characterization of relevant sperm antigens. The protein encoded by this gene is recognized by sperm agglutinating antibodies from an infertile woman. This protein is localized in germ cells of the testis at all stages of spermatogenesis and is localized to the acrosomal region of mature spermatozoa. Alternatively spliced variants that encode different protein isoforms have been described but the full-length sequences of only two have been determined.
Uniprot IDQ99932-2
Protein Accession #NP_758516
Nucleotide Accession #NM_172312
Protein Size (# AA)501
Molecular Weight53kDa
Protein InteractionsKLHL32; DTX2; SNRPC; CSTF2; PITX1; JMJD4; WHSC1L1; KDM3B; CARM1; PRMT5; PRMT1; PRMT2; RANBP9; UBQLN4; NEDD4L; RAN;
  1. What is the species homology for "SPAG8 Antibody - middle region (ARP55622_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Pig, Rabbit".

  2. How long will it take to receive "SPAG8 Antibody - middle region (ARP55622_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SPAG8 Antibody - middle region (ARP55622_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SPAG8 Antibody - middle region (ARP55622_P050)"?

    This target may also be called "SMP1, BS-84, CT142, HSD-1, SPAG3, CILD28, hSMP-1" in publications.

  5. What is the shipping cost for "SPAG8 Antibody - middle region (ARP55622_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SPAG8 Antibody - middle region (ARP55622_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SPAG8 Antibody - middle region (ARP55622_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "53kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SPAG8 Antibody - middle region (ARP55622_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SPAG8"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SPAG8"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SPAG8"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SPAG8"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SPAG8"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SPAG8"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SPAG8 Antibody - middle region (ARP55622_P050)
Your Rating
We found other products you might like!