SPAG6 Antibody - middle region (ARP53681_P050)

Catalog No: ARP53681_P050

WB Suggested Anti-SPAG6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HT1080 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SPAG6
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: HVVGQFSKVLPHDSKARRLFVTSGGLKKVQEIKAEPGSLLQEYINSINSC
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SPAG6 (ARP53681_P050) antibody is Catalog # AAP53681 (Previous Catalog # AAPP30523)

Target Info

• Reference: Mehrle,A., Nucleic Acids Res. 34 (DATABASE ISSUE), D415-D418 (2006)
• Gene Symbol: SPAG6
• Gene Full Name: Sperm associated antigen 6
• Alias Symbols: pf16, CT141, FAP194, CFAP194, Repro-SA-1
• NCBI Gene Id: 9576
• Protein Name: Sperm-associated antigen 6
• Description of Target: SPAG6 is important for structural integrity of the central apparatus in the sperm tail and for flagellar motility.The correlation of anti-sperm antibodies with cases of unexplained infertility implicates a role for these antibodies in blocking fertilization. Improved diagnosis and treatment of immunologic infertility, as well as identification of proteins for targeted contraception, are dependent on the identification and characterization of relevant sperm antigens. The protein expressed by this gene is recognized by anti-sperm antibodies from an infertile man. This protein localizes to the tail of permeabilized human sperm and contains eight contiguous armadillo repeats, a motif known to mediate protein-protein interactions. Studies in mice suggest that this protein is involved in sperm flagellar motility and maintenance of the structural integrity of mature sperm. Alternatively spliced variants that encode different protein isoforms have been described but the full-length sequences of only two have been determined.
• Uniprot ID: O75602
• Protein Accession #: NP_036575
• Nucleotide Accession #: NM_012443
• Protein Size (# AA): 509
• Molecular Weight: 56kDa
• Protein Interactions: APP; SPAG16;