SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: OABB01926
Size:100UG
Price: $432.00
SKU
OABB01926
Availability: Domestic: within 1-2 week delivery | International: within 1-2 week delivery
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for SP5 Antibody - middle region (OABB01926)
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHamster|Human
Product FormatLyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
ClonalityPolyclonal
ClonePolyclonal
IsotypeRabbit IgG
HostRabbit
ApplicationIHC, WB
Additional InformationNotes: WB: The detection limit for Sp5 is approximately 0.1ng/lane under reducing conditions.
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
::Background: Sp5 is mapped to 2q31.1. It is a member of the Sp family of zinc finger transcription factors. Like other family members, the Sp5 protein contains a Cys2His2 zinc finger DNA binding domain at the C-terminus. Elevated expression of Sp5 has been noted in several human tumors including hepatocellular carcinoma, gastric cancer and colon cancer.
Reconstitution and Storage2°C to 8°C|-20°C
ImmunogenPolypeptide
PurificationAffinity Purified
Peptide SequenceSynthetic peptide located within the following region: DFAQYQSQIAALLQTKAPLAATARRCRRCR
Concentration500 ug/ml
SpecificityNo cross reactivity with other proteins.
Application InfoWestern blot: 0.1-0.5 ug/ml: Human
Immunohistochemistry (Paraffin-embedded Section): 0.5-1 ug/ml: Human: By Heat
Reference1. Chen Y; Guo Y; Ge X; Itoh H; Watanabe A; Fujiwara T; Kodama T; Aburatani H: Elevated expression and potential roles of human Sp5, a member of Sp transcription factor family, in human cancers. Biochem Biophys Res Commun, 2006 Feb 17.
2. Simmons SO; Horowitz JM: Nkx3.1 binds and negatively regulates the transcriptional activity of Sp-family members in prostate-derived cells. Biochem J, 2006 Jan 1.
Storage BufferEach vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Gene SymbolSP5
Gene Full NameSp5 transcription factor
Alias Symbolstranscription factor Sp5.
NCBI Gene Id389058
Protein NameTranscription factor Sp5
Description of TargetBinds to GC boxes promoters elements. Probable transcriptional activator that has a role in the coordination of changes in transcription required to generate pattern in the developing embryo (By similarity).
Uniprot IDQ6BEB4
Molecular Weight41964 MW
  1. What is the species homology for "SP5 Antibody - middle region (OABB01926)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Hamster|Human".

  2. How long will it take to receive "SP5 Antibody - middle region (OABB01926)"?

    This item is available "Domestic: within 1-2 week delivery | International: within 1-2 week delivery".

  3. What buffer format is "SP5 Antibody - middle region (OABB01926)" provided in?

    This item is provided in "Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SP5 Antibody - middle region (OABB01926)"?

    This target may also be called "transcription factor Sp5." in publications.

  5. What is the shipping cost for "SP5 Antibody - middle region (OABB01926)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SP5 Antibody - middle region (OABB01926)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SP5 Antibody - middle region (OABB01926)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "41964 MW".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SP5 Antibody - middle region (OABB01926)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SP5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SP5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SP5"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SP5"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SP5"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SP5"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SP5 Antibody - middle region (OABB01926)
Your Rating