Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

SP100 Antibody - middle region : FITC (ARP72581_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP72581_P050 Unconjugated

ARP72581_P050-HRP Conjugated

ARP72581_P050-Biotin Conjugated

Gene Symbol:
SP100
NCBI Gene Id:
6672
Swissprot Id:
P23497
Protein Accession #:
NP_003104
Alias Symbols:
SP100,
Replacement Item:
This antibody may replace item sc-16328 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a subnuclear organelle and major component of the PML (promyelocytic leukemia)-SP100 nuclear bodies. PML and SP100 are covalently modified by the SUMO-1 modifier, which is considered crucial to nuclear body interactions. The encoded protein binds heterochromatin proteins and is thought to play a role in tumorigenesis, immunity, and gene regulation. Alternatively spliced variants have been identified for this gene; one of which encodes a high-mobility group protein.
Protein Size (# AA):
879
Molecular Weight:
96kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SP100.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SP100.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of Human SP100
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: IIVISSEDSEGSTDVDEPLEVFISAPRSEPVINNDNPLESNDEKEGQEAT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
RBM39; DYRK2; SUMO1; UBE2I; SP100; SUMO2; SUMO3; PHC1; DNMT3A; ACTN2; RTP5; L3MBTL3; TRAF3IP3; GIPC2; AMOTL2; ZC2HC1A; SENP1; CBX5; USPL1; UBC; PML; VPS25; PUS1; CRTAP; TOM1L1; SERPINE2; AGL; CREM; DSTN; AHCYL1; SEC23A; IGBP1; ETS1; ARID3A; TERF2IP; TERF2
Blocking Peptide:
For anti-SP100 (ARP72581_P050-FITC) antibody is Catalog # AAP72581
Datasheets/Manuals:
Printable datasheet for anti-SP100 (ARP72581_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...