Search Antibody, Protein, and ELISA Kit Solutions

SP100 Antibody - middle region (ARP72581_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP72581_P050-FITC Conjugated

ARP72581_P050-HRP Conjugated

ARP72581_P050-Biotin Conjugated

Gene Symbol:
SP100
NCBI Gene Id:
6672
Swissprot Id:
P23497
Protein Accession #:
NP_003104
Alias Symbols:
SP100,
Replacement Item:
This antibody may replace item sc-16328 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a subnuclear organelle and major component of the PML (promyelocytic leukemia)-SP100 nuclear bodies. PML and SP100 are covalently modified by the SUMO-1 modifier, which is considered crucial to nuclear body interactions. The encoded protein binds heterochromatin proteins and is thought to play a role in tumorigenesis, immunity, and gene regulation. Alternatively spliced variants have been identified for this gene; one of which encodes a high-mobility group protein.
Protein Size (# AA):
879
Molecular Weight:
96kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SP100.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SP100.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of Human SP100
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: IIVISSEDSEGSTDVDEPLEVFISAPRSEPVINNDNPLESNDEKEGQEAT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
RBM39; DYRK2; SUMO1; UBE2I; SP100; SUMO2; SUMO3; PHC1; DNMT3A; ACTN2; RTP5; L3MBTL3; TRAF3IP3; GIPC2; AMOTL2; ZC2HC1A; SENP1; CBX5; USPL1; UBC; PML; VPS25; PUS1; CRTAP; TOM1L1; SERPINE2; AGL; CREM; DSTN; AHCYL1; SEC23A; IGBP1; ETS1; ARID3A; TERF2IP; TERF2
Blocking Peptide:
For anti-SP100 (ARP72581_P050) antibody is Catalog # AAP72581
Datasheets/Manuals:
Printable datasheet for anti-SP100 (ARP72581_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...