Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP72581_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP72581_P050-FITC Conjugated

ARP72581_P050-HRP Conjugated

ARP72581_P050-Biotin Conjugated

SP100 Antibody - middle region (ARP72581_P050)

Catalog#: ARP72581_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-16328 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human SP100
PurificationAffinity Purified
Peptide SequenceSynthetic peptide located within the following region: IIVISSEDSEGSTDVDEPLEVFISAPRSEPVINNDNPLESNDEKEGQEAT
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-SP100 (ARP72581_P050) antibody is Catalog # AAP72581
Datasheets/ManualsPrintable datasheet for anti-SP100 (ARP72581_P050) antibody
Gene SymbolSP100
Alias SymbolsSP100,
NCBI Gene Id6672
Description of TargetThis gene encodes a subnuclear organelle and major component of the PML (promyelocytic leukemia)-SP100 nuclear bodies. PML and SP100 are covalently modified by the SUMO-1 modifier, which is considered crucial to nuclear body interactions. The encoded protein binds heterochromatin proteins and is thought to play a role in tumorigenesis, immunity, and gene regulation. Alternatively spliced variants have been identified for this gene; one of which encodes a high-mobility group protein.
Swissprot IdP23497
Protein Accession #NP_003104
Protein Size (# AA)879
Molecular Weight96kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express SP100.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express SP100.
Protein InteractionsRBM39; DYRK2; SUMO1; UBE2I; SP100; SUMO2; SUMO3; PHC1; DNMT3A; ACTN2; RTP5; L3MBTL3; TRAF3IP3; GIPC2; AMOTL2; ZC2HC1A; SENP1; CBX5; USPL1; UBC; PML; VPS25; PUS1; CRTAP; TOM1L1; SERPINE2; AGL; CREM; DSTN; AHCYL1; SEC23A; IGBP1; ETS1; ARID3A; TERF2IP; TERF2
Write Your Own Review
You're reviewing:SP100 Antibody - middle region (ARP72581_P050)
Your Rating
Aviva Travel Grant
Aviva Validation Data
Assay Development
Aviva Tissue Tool