Soybean P34 Protein (OPPA00393)

Catalog No: OPPA00393 (Formerly GWB-CFBCCD)

Size:100UG

Product Info

• Predicted Species Reactivity: Glycine max
• Product Format: Sterile filtered colorless solution. Supplied in 50mM Tris-HCl, pH 8.0 and 60mM NaCl.
• Application: ELISA, WB
• Reconstitution and Storage: Soybean P34 although stable at 4C for 1 week, should be stored below -18C. Please prevent freeze thaw cycles.
• Purification: Purified by proprietary chromatographic technique.
• Purity: Protein is >95% pure as determined by 10% PAGE (coomassie staining) and RP-HPLC.
• Protein Sequence: MLTKFTTQKQVSSLFQLWKSEHGRVYHNHEEEAKRLEIFKNNLNYIRDMNANRKSPHSHRLGLNKFADITPQEFSKKYLQAPKDVSQQIKMANKKMKKEQYSCDHPPASWDWRKKGVITQVKYQGGCGSGWAFSATGAIEAAHAIATGDLVSLSEQELVDCVEESEGCYNGWHYQSFEWVLEHGGIATDDDYPYRAKEGRCKANKIQDKVTIDGYETLIMSDESTESETEQAFLSAILEQPISVSIDAKDFHLYTGGIYDGENCTSPYGINHFVLLVGYGSADGVDYWIAKNSWGEDWGEDGYIWIQRNTGNLLGVCGMNYFASYPTKEESETLVSARVKGHRRVDHSPL
• Source: E. coli
• Tag: His tag at C-terminus.

Target Info

• Gene Symbol: Soy Bean P34
• Alias Symbols: Soybean P34, Soybean P34 Protein Recombinant
• Description of Target: The P34 protein is the main allergen for soybean sensitive humans. Soybean protein P34, a thiol protease belonging to the papain family, is a monomeric allergen having an N-terminal amino acid sequence and amino acid composition identical to that of the seed 34kDa protein. It is an insoluble glycoprotein having a pI of 4.5 and a calculated mass of 28.643 Dalton, representing 2–3% of total soybean protein. Upon glycosylation, the mass will be somewhat larger, resulting in a ~32kDa band in non-reduced SDS PAGE gels. It exhibits no enzymatic function due to an absence of the catalytic cysteine. P34 is stored in storage vacuoles of soybean cotyledons.
• Protein Size (# AA): Recombinant