SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP37986_P050-Biotin
Size:100ul
Price: $434.00
SKU
ARP37986_P050-Biotin
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

SOX9 Antibody - C-terminal region : Biotin (ARP37986_P050-Biotin)

Datasheets/ManualsPrintable datasheet for anti-SOX9 (ARP37986_P050-Biotin) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationWB, FC
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human SOX9
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Peptide SequenceSynthetic peptide located within the following region: AGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQ
Concentration0.5 mg/ml
Blocking PeptideFor anti-SOX9 (ARP37986_P050-Biotin) antibody is Catalog # AAP37986 (Previous Catalog # AAPP23274)
ReferenceVidal,V.P., (2008) J. Cutan. Pathol. 35 (4), 373-379
Publications

Lau, E.-L., Lee, M.-F. & Chang, C.-F. Conserved sex-specific timing of meiotic initiation during sex differentiation in the protandrous black porgy Acanthopagrus schlegelii. Biol. Reprod. 88, 150 (2013). IHC, Dog, Human, Rat, Pig, Horse, Rabbit, Mouse, Bovine, Guinea pig, Zebrafish 23616595

Kallas, A., Pook, M., Trei, A. & Maimets, T. SOX2 Is Regulated Differently from NANOG and OCT4 in Human Embryonic Stem Cells during Early Differentiation Initiated with Sodium Butyrate. Stem Cells Int. 2014, 298163 (2014). WB, Human, Mouse 24707296

Gene SymbolSOX9
Gene Full NameSRY (sex determining region Y)-box 9
Alias SymbolsCMD1, SRA1, CMPD1, SRXX2, SRXY10
NCBI Gene Id6662
Protein NameTranscription factor SOX-9
Description of TargetSOX9 recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. It acts during chondrocyte differentiation and, with steroidogenic factor 1, regulates transcription of the anti-Muellerian hormone (AMH) gene. Deficiencies lead to the skeletal malformation syndrome campomelic dysplasia, frequently with sex reversal.The protein encoded by this gene recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. It acts during chondrocyte differentiation and, with steroidogenic factor 1, regulates transcription of the anti-Muellerian hormone (AMH) gene. Deficiencies lead to the skeletal malformation syndrome campomelic dysplasia, frequently with sex reversal. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDP48436
Protein Accession #NP_000337
Nucleotide Accession #NM_000346
Protein Size (# AA)509
Molecular Weight56kDa
Protein InteractionsZBTB7A; SCX; HERC1; UBC; SOX9; ATP6V1H; ctnnb1-a; RUNX2; SMAD3; SMAD2; EP300; CREB3L4; SPEN; KPNB1; TRAF2; CREBBP; MED12; NR5A1; MAF; HSPA1A; CREB1;
  1. What is the species homology for "SOX9 Antibody - C-terminal region : Biotin (ARP37986_P050-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish".

  2. How long will it take to receive "SOX9 Antibody - C-terminal region : Biotin (ARP37986_P050-Biotin)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SOX9 Antibody - C-terminal region : Biotin (ARP37986_P050-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SOX9 Antibody - C-terminal region : Biotin (ARP37986_P050-Biotin)"?

    This target may also be called "CMD1, SRA1, CMPD1, SRXX2, SRXY10" in publications.

  5. What is the shipping cost for "SOX9 Antibody - C-terminal region : Biotin (ARP37986_P050-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SOX9 Antibody - C-terminal region : Biotin (ARP37986_P050-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SOX9 Antibody - C-terminal region : Biotin (ARP37986_P050-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "56kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SOX9 Antibody - C-terminal region : Biotin (ARP37986_P050-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SOX9"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SOX9"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SOX9"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SOX9"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SOX9"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SOX9"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SOX9 Antibody - C-terminal region : Biotin (ARP37986_P050-Biotin)
Your Rating
We found other products you might like!