Search Antibody, Protein, and ELISA Kit Solutions

SOX9 Antibody - C-terminal region (ARP37986_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP37986_P050-FITC Conjugated

ARP37986_P050-HRP Conjugated

ARP37986_P050-Biotin Conjugated

Tested Species Reactivity:
Human, Rat
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB, FC
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
SOX9
Official Gene Full Name:
SRY (sex determining region Y)-box 9
NCBI Gene Id:
6662
Protein Name:
Transcription factor SOX-9
Swissprot Id:
P48436
Protein Accession #:
NP_000337
Nucleotide Accession #:
NM_000346
Alias Symbols:
CMD1, CMPD1, SRA1
Replacement Item:
This antibody may replace item sc-126032 from Santa Cruz Biotechnology.
Description of Target:
SOX9 recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. It acts during chondrocyte differentiation and, with steroidogenic factor 1, regulates transcription of the anti-Muellerian hormone (AMH) gene. Deficiencies lead to the skeletal malformation syndrome campomelic dysplasia, frequently with sex reversal.The protein encoded by this gene recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. It acts during chondrocyte differentiation and, with steroidogenic factor 1, regulates transcription of the anti-Muellerian hormone (AMH) gene. Deficiencies lead to the skeletal malformation syndrome campomelic dysplasia, frequently with sex reversal. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
509
Molecular Weight:
56kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SOX9.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SOX9.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human SOX9
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-SOX9 (ARP37986_P050)
Peptide Sequence:
Synthetic peptide located within the following region: AGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQ
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
ZBTB7A; SCX; HERC1; UBC; SOX9; ATP6V1H; ctnnb1-a; RUNX2; SMAD3; SMAD2; EP300; CREB3L4; SPEN; KPNB1; TRAF2; CREBBP; MED12; NR5A1; MAF; HSPA1A; CREB1;
Blocking Peptide:
For anti-SOX9 (ARP37986_P050) antibody is Catalog # AAP37986 (Previous Catalog # AAPP23274)
Datasheets/Manuals:
Printable datasheet for anti-SOX9 (ARP37986_P050) antibody
Target Reference:
Vidal,V.P., (2008) J. Cutan. Pathol. 35 (4), 373-379
Publications:

Lau, E.-L., Lee, M.-F. & Chang, C.-F. Conserved sex-specific timing of meiotic initiation during sex differentiation in the protandrous black porgy Acanthopagrus schlegelii. Biol. Reprod. 88, 150 (2013). WB, FC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 23616595

Product Reviews

Average Rating:
2 reviews
5 star
1
4 star
1
3 star
0
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

2 Item(s)

50/02/2019 01:42
  • Overall Experience:
  • Quality:
Canine testis in WB

Submitted by:
Jasmine Penny

SOX9

1. Sample type: Canine testis lysate

2. Primary antibody dilution: 1:700

3. Secondary antibody and dilution: 1:7000

4. Protocol: Standard denaturing SDS-PAGE followed by electroblotting onto a PVDF membrane and chemiluminecsent detection.

0
0
Reply
Show more comments (-2) Hide comments
02/01/2017 16:23
  • Overall Experience:
  • Quality:
Product Review: SOX9 antibody -C-terminal region (ARP37986_P050) in Human H9 cells and Human H9 cells+Na+Butyrate using FC
Product Page for SOX9 antibody-C-terminal region (ARP37986_P050)

Application: Flow Cytometry
Researcher: Dr. Ade Kallas, University of tartu
Species + Tissue/Cell type: A. Human H9 cells and B. Human H9 cells+Na+Butyrate
Primary antibody dilution: 2ug+1x106 cells
Secondary antibody: Chicken anti rabbit-Alexa Fluor 488
Secondary antibody dilution: 1:1000


Questionnaire:
How do Aviva's reagents play a role in your experimental goals? Different antibodies are used to detect antigens in cells for studying their expression profile.
How would you rate this antibody on a scale from 1-5 (5=best) and why? 4
Would you use this antibody in future experiments? Yes
Have you used another antibody which has worked in your application? No
Do you believe the information about the reagent on Aviva's website is correct? Yes
If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not? Yes. This antibody will be included into panel of antibodies used for detecting differentation of human embryonic stem cells.
How did you store the antibody after re-suspension? One week at 4 C, then aliquots at -20 C for longer period.
Sample Description (please include species type and tissue/cell type): Human embryonic stem cells (H9 cell line, Wicell, USA) in pluripotent state and at day 3 of differentiation initiated with Sodium Butyrate.
How many different experimental trials were conducted using the antibody sample? Cells at pluripotent state and at differentiation (Day 3) were analysed 3 times.
Primary antibody dilution, incubation time and temperature, conjugate type (fluorophore, quantum dot, isotope, etc. ) used: 2 ul of antibody solution (1mg/ml) was used to stain 1x106 cells for 30 min at RT. Another sample was stained in the same conditions with isotype control antibody (Rabbit IgG, ChiP grade, Abcam). Isotype control antibody was added in the amount equal with SOX9 antibody protein concentration.
Other labeling reagents used (please include dilution, incubation time and temperature and conjugate type): As a secondary regaent we used chicken anti-rabbit IgG conjugated with Alexa Fluor 488 (e-Bioscience) at dilution 1:1000 in 100 ul PBS (caontaining 1% BSA, and 2mM EDTA) for 30 min at RT.
What controls were used in your experiment? Rabbit IgG (Chip grade, Abcam) was used as an isotype control in every experiment.
AS a biological negative control we used pluripotent undifferentiated hESC cells and for positive control
differentiated hESC cells (hESC treated with Sodium Butyrate for 3 days according to differentiation protocol to induce cells of endodermal lineage) were used.
From your Flow images, briefly explain the different populations represented: Histogram with black line represents the staining with SOX9 antibody (Day 0 and Day 3 at differentiation).
Histogram with red line represents the staining with isotype control antibody. There is a detectable shift in fluorecsence intensity of cell population representing cells expressing SOX9 at Day 3.
0
0
Reply
Show more comments (-2) Hide comments

2 Item(s)

What kind of abuse are you reporting?
    Please, wait...