Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

SOX5 Antibody - C-terminal region (ARP33323_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP33323_P050-FITC Conjugated

ARP33323_P050-HRP Conjugated

ARP33323_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
SRY (sex determining region Y)-box 5
NCBI Gene Id:
Protein Name:
SRY (Sex determining region Y)-box 5 isoform c variant EMBL BAD97256.1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
L-SOX5, MGC35153
Replacement Item:
This antibody may replace item sc-20091 from Santa Cruz Biotechnology.
Description of Target:
SOX5 encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The encoded protein may play a role in chondrogenesis. A pseudogene of this gene is located on chromosome 8.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SOX5.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SOX5.
The immunogen is a synthetic peptide directed towards the C terminal region of human SOX5
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-SOX5 (ARP33323_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PEPGMPVIQSTYGVKGEEPHIKEEIQAEDINGEIYDEYDEEEDDPDVDYG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-SOX5 (ARP33323_P050) antibody is Catalog # AAP33323 (Previous Catalog # AAPP04365)
Printable datasheet for anti-SOX5 (ARP33323_P050) antibody
Designed to recognize all five isoforms of human SOX5 (84, 82, 42, 71 and 83kDa)

Aza-Carmona, M. et al. SHOX interacts with the chondrogenic transcription factors SOX5 and SOX6 to activate the aggrecan enhancer. Hum. Mol. Genet. 20, 1547-59 (2011). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 21262861

Boije, H. et al. Sonic Hedgehog-signalling patterns the developing chicken comb as revealed by exploration of the pea-comb mutation. PLoS One 7, e50890 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23227218

Fernandes, A. M. et al. Similar properties of chondrocytes from osteoarthritis joints and mesenchymal stem cells from healthy donors for tissue engineering of articular cartilage. PLoS One 8, e62994 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23671648

Kiselak, E. A. et al. Transcriptional regulation of an axonemal central apparatus gene, sperm-associated antigen 6, by a SRY-related high mobility group transcription factor, S-SOX5. J. Biol. Chem. 285, 30496-505 (2010). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 20668334

Martelli, M. L. et al. Exploiting orthologue diversity for systematic detection of gain-of-function phenotypes. BMC Genomics 9, 254 (2008). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 18510758

Naveau, E. et al. Alteration of rat fetal cerebral cortex development after prenatal exposure to polychlorinated biphenyls. PLoS One 9, e91903 (2014). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 24642964

Pytel, P. et al. Neoplasms with schwannian differentiation express transcription factors known to regulate normal schwann cell development. Int. J. Surg. Pathol. 18, 449-57 (2010). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 20034979

Tchougounova, E. et al. Sox5 can suppress platelet-derived growth factor B-induced glioma development in Ink4a-deficient mice through induction of acute cellular senescence. Oncogene 28, 1537-48 (2009). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 19219070

Torii, M., Hashimoto-Torii, K., Levitt, P. & Rakic, P. Integration of neuronal clones in the radial cortical columns by EphA and ephrin-A signalling. Nature 461, 524-8 (2009). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 19759535

Wright, D. et al. Copy number variation in intron 1 of SOX5 causes the Pea-comb phenotype in chickens. PLoS Genet. 5, e1000512 (2009). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 19521496

Yu, J. et al. Array-based comparative genomic hybridization identifies CDK4 and FOXM1 alterations as independent predictors of survival in malignant peripheral nerve sheath tumor. Clin. Cancer Res. 17, 1924-34 (2011). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 21325289

Zhang, L; Liu, Y; Li, W; Zhang, Q; Li, Y; Liu, J; Min, J; Shuang, C; Song, S; Zhang, Z; Transcriptional regulation of human sperm-associated antigen 16 gene by S-SOX5. 18, 2 (2017). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 28137312

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...