Size:100 ul
$319.00
In Stock
SKU
ARP33323_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP33323_P050-FITC Conjugated

ARP33323_P050-HRP Conjugated

ARP33323_P050-Biotin Conjugated

SOX5 Antibody - C-terminal region (ARP33323_P050)

Catalog#: ARP33323_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-20091 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human SOX5
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-SOX5 (ARP33323_P050)
Peptide Sequence Synthetic peptide located within the following region: PEPGMPVIQSTYGVKGEEPHIKEEIQAEDINGEIYDEYDEEEDDPDVDYG
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-SOX5 (ARP33323_P050) antibody is Catalog # AAP33323 (Previous Catalog # AAPP04365)
Datasheets/Manuals Printable datasheet for anti-SOX5 (ARP33323_P050) antibody
Specificity Designed to recognize all five isoforms of human SOX5 (84, 82, 42, 71 and 83kDa)
Publications

Aza-Carmona, M. et al. SHOX interacts with the chondrogenic transcription factors SOX5 and SOX6 to activate the aggrecan enhancer. Hum. Mol. Genet. 20, 1547-59 (2011). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 21262861

Boije, H. et al. Sonic Hedgehog-signalling patterns the developing chicken comb as revealed by exploration of the pea-comb mutation. PLoS One 7, e50890 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23227218

Fernandes, A. M. et al. Similar properties of chondrocytes from osteoarthritis joints and mesenchymal stem cells from healthy donors for tissue engineering of articular cartilage. PLoS One 8, e62994 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23671648

Kiselak, E. A. et al. Transcriptional regulation of an axonemal central apparatus gene, sperm-associated antigen 6, by a SRY-related high mobility group transcription factor, S-SOX5. J. Biol. Chem. 285, 30496-505 (2010). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 20668334

Martelli, M. L. et al. Exploiting orthologue diversity for systematic detection of gain-of-function phenotypes. BMC Genomics 9, 254 (2008). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 18510758

Naveau, E. et al. Alteration of rat fetal cerebral cortex development after prenatal exposure to polychlorinated biphenyls. PLoS One 9, e91903 (2014). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 24642964

Pytel, P. et al. Neoplasms with schwannian differentiation express transcription factors known to regulate normal schwann cell development. Int. J. Surg. Pathol. 18, 449-57 (2010). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 20034979

Tchougounova, E. et al. Sox5 can suppress platelet-derived growth factor B-induced glioma development in Ink4a-deficient mice through induction of acute cellular senescence. Oncogene 28, 1537-48 (2009). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 19219070

Torii, M., Hashimoto-Torii, K., Levitt, P. & Rakic, P. Integration of neuronal clones in the radial cortical columns by EphA and ephrin-A signalling. Nature 461, 524-8 (2009). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 19759535

Wright, D. et al. Copy number variation in intron 1 of SOX5 causes the Pea-comb phenotype in chickens. PLoS Genet. 5, e1000512 (2009). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 19521496

Yu, J. et al. Array-based comparative genomic hybridization identifies CDK4 and FOXM1 alterations as independent predictors of survival in malignant peripheral nerve sheath tumor. Clin. Cancer Res. 17, 1924-34 (2011). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 21325289

Zhang, L; Liu, Y; Li, W; Zhang, Q; Li, Y; Liu, J; Min, J; Shuang, C; Song, S; Zhang, Z; Transcriptional regulation of human sperm-associated antigen 16 gene by S-SOX5. 18, 2 (2017). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 28137312

Gene Symbol SOX5
Official Gene Full Name SRY (sex determining region Y)-box 5
Alias Symbols L-SOX5, MGC35153
NCBI Gene Id 6660
Protein Name SRY (Sex determining region Y)-box 5 isoform c variant EMBL BAD97256.1
Description of Target SOX5 encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The encoded protein may play a role in chondrogenesis. A pseudogene of this gene is located on chromosome 8.
Swissprot Id P35711
Protein Accession # NP_821078
Nucleotide Accession # NM_178010
Protein Size (# AA) 377
Molecular Weight 42kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express SOX5.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express SOX5.
Protein Interactions SUMO1P1; MORN3; PRR20A; FAM46B; CBX8; ZNF581; ARID5A; KAT5; CDC23; TAF6; SOX5; LMO2; LMO1; KIFC3; CRX; AES; MED27; UQCRFS1; TTC1; RPS2; SMAD7; SMAD5; SMAD1; FTH1; CDK6; CDC25A; APP; SOX2; SOX6;
  1. What is the species homology for "SOX5 Antibody - C-terminal region (ARP33323_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "SOX5 Antibody - C-terminal region (ARP33323_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SOX5 Antibody - C-terminal region (ARP33323_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SOX5 Antibody - C-terminal region (ARP33323_P050)"?

    This target may also be called "L-SOX5, MGC35153" in publications.

  5. What is the shipping cost for "SOX5 Antibody - C-terminal region (ARP33323_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SOX5 Antibody - C-terminal region (ARP33323_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SOX5 Antibody - C-terminal region (ARP33323_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "42kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SOX5 Antibody - C-terminal region (ARP33323_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "SOX5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SOX5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SOX5"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SOX5"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SOX5"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SOX5"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SOX5 Antibody - C-terminal region (ARP33323_P050)
Your Rating
We found other products you might like!