Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

SOX4 Antibody - N-terminal region : FITC (ARP74257_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP74257_P050 Unconjugated

ARP74257_P050-HRP Conjugated

ARP74257_P050-Biotin Conjugated

Gene Symbol:
SOX4
NCBI Gene Id:
6659
Swissprot Id:
Q06945
Protein Accession #:
NP_003098
Alias Symbols:
SOX4,
Replacement Item:
This antibody may replace item sc-130633 from Santa Cruz Biotechnology.
Description of Target:
This intronless gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins, such as syndecan binding protein (syntenin). The protein may function in the apoptosis pathway leading to cell death as well as to tumorigenesis and may mediate downstream effects of parathyroid hormone (PTH) and PTH-related protein (PTHrP) in bone development. The solution structure has been resolved for the HMG-box of a similar mouse protein.
Protein Size (# AA):
474
Molecular Weight:
52kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SOX4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SOX4.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human SOX4
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: KRWKLLKDSDKIPFIREAERLRLKHMADYPDYKYRPRKKVKSGNANSSSS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
TAF5; UBE2I; ELAVL1; TP53; MDM2; EP300; tat; SDCBP;
Blocking Peptide:
For anti-SOX4 (ARP74257_P050-FITC) antibody is Catalog # AAP74257
Datasheets/Manuals:
Printable datasheet for anti-SOX4 (ARP74257_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...