Search Antibody, Protein, and ELISA Kit Solutions

SOX30 Antibody - middle region (ARP32990_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP32990_P050-FITC Conjugated

ARP32990_P050-HRP Conjugated

ARP32990_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Dog, Human, Pig
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
SRY (sex determining region Y)-box 30
NCBI Gene Id:
Protein Name:
Transcription factor SOX-30
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-114493 from Santa Cruz Biotechnology.
Description of Target:
The SOX30 gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The protein may be involved in the differentiation of developing male germ cells. This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The protein may be involved in the differentiation of developing male germ cells. Two transcript variants encoding distinct isoforms have been identified for this gene.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SOX30.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SOX30.
The immunogen is a synthetic peptide directed towards the middle region of human SOX30
Predicted Homology Based on Immunogen Sequence:
Dog: 79%; Human: 100%; Pig: 86%
Complete computational species homology data:
Anti-SOX30 (ARP32990_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GDEKGKLEAEEVMRDSMQGGAGKSPAAIREGVIKTEEPERLLEDCRLGAE
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-SOX30 (ARP32990_P050) antibody is Catalog # AAP32990 (Previous Catalog # AAPP04019)
Printable datasheet for anti-SOX30 (ARP32990_P050) antibody
Target Reference:
Koopman,P., Gene 328, 177-186 (2004)

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...