Now Offering Over 102,157 Antibodies & 44,722 Antigens!

SOX17 antibody - middle region : FITC (ARP39552_P050-FITC)

100 ul
$319.00
In Stock

Conjugation Options

ARP39552_P050 Unconjugated

ARP39552_P050-HRP Conjugated

ARP39552_P050-Biotin Conjugated

Gene Symbol:
SOX17
NCBI Gene Id:
64321
Official Gene Full Name:
SRY (sex determining region Y)-box 17
Protein Name:
Transcription factor SOX-17
Swissprot Id:
Q9H6I2
Protein Accession #:
NP_071899
Nucleotide Accession #:
NM_022454
Alias Symbols:
FLJ22252, VUR3
Replacement Item:
This antibody may replace item sc-130295 from Santa Cruz Biotechnology.
Description of Target:
The SOX17 gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins.
Protein Size (# AA):
414
Molecular Weight:
44kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SOX17.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SOX17.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human SOX17
Species Reactivity:
Dog, Guinea Pig, Human, Mouse, Rat
Predicted Homology Based on Immunogen Sequence:
Dog: 86%; Guinea Pig: 93%; Human: 100%; Mouse: 86%; Rat: 86%
Complete computational species homology data:
Anti-SOX17 (ARP39552_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RTEFEQYLHFVCKPEMGLPYQGHDSGVNLPDSHGAISSVVSDASSAVYYC
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
CTNNB1;
Blocking Peptide:
For anti-SOX17 (ARP39552_P050-FITC) antibody is Catalog # AAP39552 (Previous Catalog # AAPP23082)
Datasheets/Manuals:
Printable datasheet for anti-SOX17 (ARP39552_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
Zhang,W., (2008) Cancer Res. 68 (8), 2764-2772
Publications:

Kallas, A., Pook, M., Trei, A. & Maimets, T. SOX2 Is Regulated Differently from NANOG and OCT4 in Human Embryonic Stem Cells during Early Differentiation Initiated with Sodium Butyrate. Stem Cells Int. 2014, 298163 (2014). WB, Human, Pig, Guinea pig, Dog, Rat, Mouse 24707296

Tell us what you think about this item!

Write A Review
    Please, wait...