Now Offering Over 102,157 Antibodies & 44,722 Antigens!

SOX17 antibody - middle region (ARP39552_P050)

100 ul
$319.00
In Stock

Conjugation Options

ARP39552_P050-FITC Conjugated

ARP39552_P050-HRP Conjugated

ARP39552_P050-Biotin Conjugated

Gene Symbol:
SOX17
NCBI Gene Id:
64321
Official Gene Full Name:
SRY (sex determining region Y)-box 17
Protein Name:
Transcription factor SOX-17
Swissprot Id:
Q9H6I2
Protein Accession #:
NP_071899
Nucleotide Accession #:
NM_022454
Alias Symbols:
FLJ22252, VUR3
Replacement Item:
This antibody may replace item sc-130295 from Santa Cruz Biotechnology.
Description of Target:
The SOX17 gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins.
Protein Size (# AA):
414
Molecular Weight:
44kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB, IHC, FC
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SOX17.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SOX17.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human SOX17
Species Reactivity:
Dog, Guinea Pig, Human, Mouse, Rat
Predicted Homology Based on Immunogen Sequence:
Dog: 86%; Guinea Pig: 93%; Human: 100%; Mouse: 86%; Rat: 86%
Complete computational species homology data:
Anti-SOX17 (ARP39552_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RTEFEQYLHFVCKPEMGLPYQGHDSGVNLPDSHGAISSVVSDASSAVYYC
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
CTNNB1;
Blocking Peptide:
For anti-SOX17 (ARP39552_P050) antibody is Catalog # AAP39552 (Previous Catalog # AAPP23082)
Datasheets/Manuals:
Printable datasheet for anti-SOX17 (ARP39552_P050) antibody
Target Reference:
Zhang,W., (2008) Cancer Res. 68 (8), 2764-2772
Publications:

Kallas, A., Pook, M., Trei, A. & Maimets, T. SOX2 Is Regulated Differently from NANOG and OCT4 in Human Embryonic Stem Cells during Early Differentiation Initiated with Sodium Butyrate. Stem Cells Int. 2014, 298163 (2014). WB, IHC, FC, Dog, Guinea Pig, Human, Mouse, Rat 24707296

Average Rating:
1 review
5 star
0
4 star
1
3 star
0
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

02/01/2017 16:23
  • Overall Experience:
  • Quality:
Product Review: SOX17 antibody -middle region (ARP39552_P050) in Human H9 cells and Human H9 cells+Na+Butyrate using FC
Product Page for SOX17 antibody-middle region (ARP39552_P050)

Application: Flow Cytometry
Researcher: Dr. Ade Kallas, University of tartu
Species + Tissue/Cell type: A. Human H9 cells and B. Human H9 cells+Na+Butyrate
Primary antibody dilution: 2ug+1x106 cells
Secondary antibody: Chicken anti rabbit-Alexa Fluor 488
Secondary antibody dilution: 1:1000


Questionnaire:
How do Aviva's reagents play a role in your experimental goals? Different antibodies are used to detect antigens in cells for studying their expression profile.
How would you rate this antibody on a scale from 1-5 (5=best) and why? 4
Would you use this antibody in future experiments? Yes
Have you used another antibody which has worked in your application? No
Do you believe the information about the reagent on Aviva's website is correct? Yes
If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not? Yes. This antibody will be included into panel of antibodies used for detecting differentation of human embryonic stem cells.
How did you store the antibody after re-suspension? One week at 4 C, then aliquots at -20 C for longer period.
Sample Description (please include species type and tissue/cell type): Human embryonic stem cells (H9 cell line, Wicell, USA) in pluripotent state and at day 3 of differentiation initiated with Sodium Butyrate.
How many different experimental trials were conducted using the antibody sample? Cells at pluripotent state and at differentiation (Day 3) were analysed 3 times.
Primary antibody dilution, incubation time and temperature, conjugate type (fluorophore, quantum dot, isotope, etc. ) used: 2 ul of antibody solution (1mg/ml) was used to stain 1x106 cells for 30 min at RT. Another sample was stained in the same conditions with isotype control antibody (Rabbit IgG, ChiP grade, Abcam). Isotype control antibody was added in the amount equal with SOX17 antibody protein concentration.
Other labeling reagents used (please include dilution, incubation time and temperature and conjugate type): As a secondary regaent we used chicken anti-rabbit IgG conjugated with Alexa Fluor 488 (e-Bioscience) at dilution 1:1000 in 100 ul PBS (caontaining 1% BSA, and 2mM EDTA) for 30 min at RT.
What controls were used in your experiment? Rabbit IgG (Chip grade, Abcam) was used as an isotype control in every experiment.
AS a biological negative control we used pluripotent undifferentiated hESC cells and for positive control
differentiated hESC cells (hESC treated with Sodium Butyrate for 3 days according to differentiation protocol to induce cells of endodermal lineage) were used.
From your Flow images, briefly explain the different populations represented: Histogram with black line represents the staining with SOX17 antibody (Day 0 and Day 3 at differentiation).
Histogram with red line represents the staining with isotype control antibody. There is a detectable shift in fluorecsence intensity of cell population representing cells expressing SOX17 at Day 3.
0
0
Reply
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...