SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP58143_P050-FITC
Size:100ul
Price: $434.00
SKU
ARP58143_P050-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

SOX13 Antibody - middle region : FITC (ARP58143_P050-FITC)

Datasheets/ManualsPrintable datasheet for anti-SOX13 (ARP58143_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Dog, Guinea Pig, Horse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SOX13
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 85%; Guinea Pig: 100%; Horse: 85%; Human: 100%; Mouse: 85%; Rat: 92%
Peptide SequenceSynthetic peptide located within the following region: TARYCGSFCQHKDWEKHHHICGQTLQAQQQGDTPAVSSSVTPNSGAGSPM
Concentration0.5 mg/ml
Blocking PeptideFor anti-SOX13 (ARP58143_P050-FITC) antibody is Catalog # AAP58143 (Previous Catalog # AAPP32576)
ReferencePark,Y., Ann. N. Y. Acad. Sci. 1005, 253-258 (2003)
Gene SymbolSOX13
Gene Full NameSRY (sex determining region Y)-box 13
Alias SymbolsICA12, Sox-13
NCBI Gene Id9580
Protein NameTranscription factor SOX-13
Description of TargetSOX13 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. It has also been determined to be a type-1 diabetes autoantigen, also known as islet cell antibody 12. This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. It has also been determined to be a type-1 diabetes autoantigen, also known as islet cell antibody 12. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDQ3KQV7
Protein Accession #NP_005677
Nucleotide Accession #NM_005686
Protein Size (# AA)622
Molecular Weight69kDa
Protein InteractionsYTHDC1; SMAD7; CTBP2; SOX13;
  1. What is the species homology for "SOX13 Antibody - middle region : FITC (ARP58143_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Dog, Guinea Pig, Horse".

  2. How long will it take to receive "SOX13 Antibody - middle region : FITC (ARP58143_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SOX13 Antibody - middle region : FITC (ARP58143_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SOX13 Antibody - middle region : FITC (ARP58143_P050-FITC)"?

    This target may also be called "ICA12, Sox-13" in publications.

  5. What is the shipping cost for "SOX13 Antibody - middle region : FITC (ARP58143_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SOX13 Antibody - middle region : FITC (ARP58143_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SOX13 Antibody - middle region : FITC (ARP58143_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "69kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SOX13 Antibody - middle region : FITC (ARP58143_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SOX13"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SOX13"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SOX13"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SOX13"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SOX13"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SOX13"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SOX13 Antibody - middle region : FITC (ARP58143_P050-FITC)
Your Rating
We found other products you might like!