Search Antibody, Protein, and ELISA Kit Solutions

SOX11 Antibody - N-terminal region (ARP33327_P050)

100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP33327_P050-FITC Conjugated

ARP33327_P050-HRP Conjugated

ARP33327_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
SRY (sex determining region Y)-box 11
NCBI Gene Id:
Protein Name:
Transcription factor SOX-11
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Replacement Item:
This antibody may replace item sc-17346 from Santa Cruz Biotechnology.
Description of Target:
This intronless gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The protein may function in the developing nervous system and play a role in tumorigenesis.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SOX11.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SOX11.
The immunogen is a synthetic peptide directed towards the N terminal region of human SOX11
Predicted Homology Based on Immunogen Sequence:
Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 86%
Complete computational species homology data:
Anti-SOX11 (ARP33327_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MVQQAESLEAESNLPREALDTEEGEFMACSPVALDESDPDWCKTASGHIK
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-SOX11 (ARP33327_P050) antibody is Catalog # AAP33327 (Previous Catalog # AAPP04369)
Printable datasheet for anti-SOX11 (ARP33327_P050) antibody
Target Reference:
Wiebe,M.S., et al., (2003) J. Biol. Chem. 278 (20), 17901-17911

Li, Y. et al. Sox11 modulates neocortical development by regulating the proliferation and neuronal differentiation of cortical intermediate precursors. Acta Biochim. Biophys. Sin. (Shanghai). 44, 660-8 (2012). WB, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 22687574

Product Reviews

Average Rating:
1 review
5 star
4 star
3 star
2 star
1 star
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

78/03/2019 03:04
  • Overall Experience:
  • Quality:
SHSY5Y cells in WB

Submitted by:
Allyson Cole Strauss
MSU College of Human Medicine


1. Sample type/lane description: SHSY5Y cells

Lane description: 30ug SHSY5Y whole cell lysate

2. Primary antibody dilution: 1:500

3. Secondary antibody and dilution: Goat anti-Rabbit; 1:15,000.

4. Protocol: The extracts were run on a single gel and cut into individual strips after transfer. Transfer was onto 0.45um PVDF at 400mAmps for 45 minutes. For blocking I used StartingBlock T20. All of the antibodies were used at a 1:500 dilution in StartingBlock plus 0.1% TWEEN-20, ON, 4C. Secondary antibody was LICOR Goat anti-Rabbit at a dilution of 1:15,000, 2hr, RT. 

Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...