SOX10 Antibody - middle region : HRP (ARP33326_P050-HRP)

Catalog No: ARP33326_P050-HRP

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: IHC, WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SOX10
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 86%
• Peptide Sequence: Synthetic peptide located within the following region: PGGEAEQGGTAAIQAHYKSAHLDHRHPGEGSPMSDGNPEHPSGQSHGPPT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SOX10 (ARP33326_P050-HRP) antibody is Catalog # AAP33326

Target Info

• Gene Symbol: SOX10
• Gene Full Name: SRY (sex determining region Y)-box 10
• Alias Symbols: DOM, WS4, PCWH, WS2E, WS4C
• NCBI Gene Id: 6663
• Protein Name: Transcription factor SOX-10
• Description of Target: SOX10 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. This protein may act as a transcriptional activator after forming a protein complex with other proteins. It acts as a nucleocytoplasmic shuttle protein and is important for neural crest and peripheral nervous system development. Mutations in this gene are associated with Waardenburg-Shah and Waardenburg-Hirschsprung disease.
• Uniprot ID: P56693
• Protein Accession #: NP_008872
• Nucleotide Accession #: NM_006941
• Protein Size (# AA): 466
• Molecular Weight: 50kDa
• Protein Interactions: UBC; CDK6; EXOC5; NMI; EPAS1; POU3F2; UTF1; PAX3; UBE2I; OLIG2; HHEX; PAX6; ALX4; PRRX2; SUMO2; POU3F3; SUMO3; SOX10; SUMO1; TCF12; MEOX1; DLX5; HIVEP1; SP1; PRRX1; JUN; POU5F1; HOXC4; HOXA3; EGR2; CEBPA;