Search Antibody, Protein, and ELISA Kit Solutions

SORBS1 Antibody - middle region (ARP65048_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP65048_P050-FITC Conjugated

ARP65048_P050-HRP Conjugated

ARP65048_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
SORBS1
Official Gene Full Name:
sorbin and SH3 domain containing 1
NCBI Gene Id:
10580
Protein Name:
sorbin and SH3 domain-containing protein 1
Swissprot Id:
Q9BX66-7
Protein Accession #:
AAH42612
Nucleotide Accession #:
NM_001034954.1
Alias Symbols:
CAP, FLAF2, R85FL, SH3D5, SORB1, SH3P12
Description of Target:
This gene encodes a CBL-associated protein which functions in the signaling and stimulation of insulin. Mutations in this gene may be associated with human disorders of insulin resistance. Alternative splicing results in multiple transcript variants.
Protein Size (# AA):
628
Molecular Weight:
69 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SORBS1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SORBS1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human SORBS1
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 100%; Guinea Pig: 83%; Horse: 83%; Human: 100%; Pig: 85%; Rabbit: 92%; Rat: 92%
Complete computational species homology data:
Anti-SORBS1 (ARP65048_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SERRVGEQDSAPTQEKPTSPGKAIEKRAKDDSRRVVKSTQDLSDVSMDEV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
LATS2; YWHAB; PILRA; SLC10A3; RPL4; CDK6; nef; FRS2; SH2B2; TENM1; FLOT1; VCL; SRC; SOS1; NTRK1; CBL; CASP8; ABL1; KHDRBS1; SEMA6A; MAP4K3; PGR; ADAM15; PAK2; PXN; INPPL1; PTK2; INSM1; EFNB1; MLLT4; INSR; ACTA1; PTK2B; EIF6;
Blocking Peptide:
For anti-SORBS1 (ARP65048_P050) antibody is Catalog # AAP65048
Datasheets/Manuals:
Printable datasheet for anti-SORBS1 (ARP65048_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...