SOD2 Antibody - N-terminal region (ARP58529_P050)

Catalog No: ARP58529_P050

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.

WB Suggested Anti-SOD2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Placenta

Host: Rabbit
Target Name: NOP56
Sample Type: Human Fetal Muscle
Antibody Dilution: 1.0ug/ml

Host: Rabbit
Target Name: NOP56
Sample Type: Human Fetal Brain
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human, Rat
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SOD2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86%
• Peptide Sequence: Synthetic peptide located within the following region: MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLH
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SOD2 (ARP58529_P050) antibody is Catalog # AAP58529 (Previous Catalog # AAPP34826)
• Enhanced Validation:

  Relative Expression (Western Blot)

Target Info

• Reference: Martin,R.C., (2008) DNA Cell Biol. 27 (6), 321-323
• Gene Symbol: SOD2
• Gene Full Name: Superoxide dismutase 2, mitochondrial
• Alias Symbols: IPOB, IPO-B, MNSOD, MVCD6, GClnc1, Mn-SOD
• NCBI Gene Id: 6648
• Protein Name: Superoxide dismutase [Mn], mitochondrial
• Description of Target: SOD2 is a member of the iron/manganese superoxide dismutase family. SOD2 is a mitochondrial protein that forms a homotetramer and binds one manganese ion per subunit. This protein binds to the superoxide byproducts of oxidative phosphorylation and converts them to hydrogen peroxide and diatomic oxygen. Mutations in this gene encoding SOD2 have been associated with idiopathic cardiomyopathy (IDC), premature aging, sporadic motor neuron disease, and cancer.This gene is a member of the iron/manganese superoxide dismutase family. It encodes a mitochondrial protein that forms a homotetramer and binds one manganese ion per subunit. This protein binds to the superoxide byproducts of oxidative phosphorylation and converts them to hydrogen peroxide and diatomic oxygen. Mutations in this gene have been associated with idiopathic cardiomyopathy (IDC), premature aging, sporadic motor neuron disease, and cancer. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
• Uniprot ID: P04179
• Protein Accession #: NP_000627
• Nucleotide Accession #: NM_000636
• Protein Size (# AA): 222
• Molecular Weight: 25 kDa
• Protein Interactions: CYP4F12; UBC; SOD2; SOD1; APP; NABP2; TBL2; ZC3H11A; VAPA; STX7; UBL4A; ALDH5A1; USP36; H2AFX; SUMO1; NOL12; HDHD2; GET4; RPS3A; RAB4A; AURKA;