SOD2 Antibody - C-terminal region (OABB01925)

Catalog No: OABB01925

Size:100UG

Anti-SOD2 Picoband antibody, OABB01925, Western blotting
All lanes: Anti SOD2 (OABB01925) at 0.5ug/ml
Lane 1: Mouse Testis Tissue Lysate at 50ug
Lane 2: Mouse Lung Tissue Lysate at 50ug
Lane 3: Mouse Cardiac Muscle Tissue Lysate at 50ug
Lane 4: Mouse Liver Tissue Lysate at 50ug
Lane 5: HEPG2 Whole Cell Lysate at 40ug
Predicted bind size: 25KD
Observed bind size: 25KD

Anti-SOD2 Picoband antibody, OABB01925, IHC(P)
IHC(P): Human Mammary Cancer Tissue

Product Info

• Tested Species Reactivity: Human, Mouse
• Predicted Species Reactivity: Hamster|Human|Mouse|Rat
• Product Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Clonality: Polyclonal
• Clone: Polyclonal
• Isotype: Rabbit IgG
• Host: Rabbit
• Application: Immunocytochemistry|Immunohistochemistry|Western blot
• Additional Information: Notes: WB: The detection limit for SOD2 is approximately 0.1ng/lane under reducing conditions.
  Tested Species: In-house tested species with positive results.
  By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
  Other applications have not been tested.
  Optimal dilutions should be determined by end users.
  Background: SOD2(Superoxide Dismutase 2), also called IPO-B or MNSOD, is a mitochondrial matrix enzyme that scavenges oxygen radicals produced by the extensive oxidation-reduction and electron transport reactions occurring in mitochondria. This gene is a member of the iron/manganese superoxide dismutase family. Using a somatic cell hybrid panel containing different segments of chromosome 6, they demonstrated that SOD2 is located in the region 6q25.3-qter which, together with the FISH analysis, indicated that SOD2 is in the distal portion of 6q25. The SOD2 gene encodes an intramitochondrial free radical scavenging enzyme that is the first line of defense against superoxide produced as a byproduct of oxidative phosphorylation. Adeno-associated viral delivery of the human SOD2 gene resulted in suppression of optic nerve degeneration and rescue of retinal ganglion cells. The findings suggested that reactive oxygen species contributed to retinal cell death and optic nerve damage in mice with complex I deficiency, and that expression of SOD2 attenuated the disease process.
• Reconstitution and Storage: 2°C to 8°C|-20°C
• Immunogen: Polypeptide
• Purification: Affinity Purified
• Peptide Sequence: Synthetic peptide located within the following region: QYKNVRPDYLKAIWNVINWENVTERYMACKK
• Concentration: 500 ug/ml
• Specificity: No cross reactivity with other proteins.
• Application Info: Western blot: 0.1-0.5 ug/ml
  Immunohistochemistry (Paraffin-embedded Section): By Heat
  Immunocytochemistry : 0.5-1 ug/ml
• Reference: 1. Bastaki, M., Huen, K., Manzanillo, P., Chande, N., Chen, C., Balmes, J. R., Tager, I. B., Holland, N. Genotype-activity relationship for Mn-superoxide dismutase, glutathione peroxidase 1 and catalase in humans. Pharmacogenet. Genomics 16: 279-286, 2006.
  2. Creagan, R., Tischfield, J., Ricciuti, F., Ruddle, F. H. Chromosome assignments of genes in man using mouse-human somatic cell hybrids: mitochondrial superoxide dismutase (indophenol oxidase-B, tetrameric) to chromosome 6. Humangenetik 20: 203-209, 1973.
  3. Hiroi, S., Harada, H., Nishi, H., Satoh, M., Nagai, R., Kimura, A. Polymorphisms in the SOD2 and HLA-DRB1 genes are associated with nonfamilial idiopathic dilated cardiomyopathy in Japanese. Biochem. Biophys. Res. Commun. 261: 332-339, 1999.
  
• Storage Buffer: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Description: Rabbit IgG polyclonal antibody for Superoxide dismutase [Mn], mitochondrial(SOD2) detection. Tested with WB, IHC-P, ICC in Human;Mouse.

Target Info

• Gene Symbol: SOD2
• Gene Full Name: superoxide dismutase 2
• Alias Symbols: epididymis secretory sperm binding protein;gastric cancer-associated lncRNA 1;GClnc1;indophenoloxidase B;IPOB;IPO-B;manganese-containing superoxide dismutase;mangano-superoxide dismutase;Mn superoxide dismutase;Mn-SOD;MNSOD;MVCD6;superoxide dismutase [Mn], mitochondrial;superoxide dismutase 2, mitochondrial.
• NCBI Gene Id: 6648
• Protein Name: Superoxide dismutase [Mn], mitochondrial
• Description of Target: Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems.
• Uniprot ID: P04179
• Molecular Weight: 24722 MW