SOD1 Recombinant Protein (Mouse) (OPCA00225)

Catalog No: OPCA00225

Product Info

• Predicted Species Reactivity: Mouse|Mus musculus
• Product Format: Liquid or Lyophilized powder
• Additional Information: Tag information : His tag
  
• Reconstitution and Storage: -20°C or -80°C
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: AMKAVCVLKGDGPVQGTIHFEQKASGEPVVLSGQITGLTEGQHGFHVHQYGDNTQGCTSAGPHFNPHSKKHGGPADEERHVGDLGNVTAGKDGVANVSIEDRVISLSGEHSIIGRTMVVHEKQDDLGKGGNEESTKTGNAGSRLACGVIGIAQ
• Protein Sequence: AMKAVCVLKGDGPVQGTIHFEQKASGEPVVLSGQITGLTEGQHGFHVHQYGDNTQGCTSAGPHFNPHSKKHGGPADEERHVGDLGNVTAGKDGVANVSIEDRVISLSGEHSIIGRTMVVHEKQDDLGKGGNEESTKTGNAGSRLACGVIGIAQ
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 2-154 aa
• Tag: N-terminal 6xHis-tagged

Target Info

• Reference: Label-free quantitative proteomics of the lysine acetylome in mitochondria identifies substrates of SIRT3 in metabolic pathways.Rardin M.J., Newman J.C., Held J.M., Cusack M.P., Sorensen D.J., Li B., Schilling B., Mooney S.D., Kahn C.R., Verdin E., Gibson B.W.Proc. Natl. Acad. Sci. U.S.A. 110:6601-6606(2013)
• Gene Symbol: Sod1
• Gene Full Name: superoxide dismutase 1, soluble
• Alias Symbols: B430204E11Rik;Cu(2+)-Zn2+ superoxide dismutase;Cu/Zn-;Cu/Zn-SOD;CuZn;CuZnSOD;I;Ip;Ipo1;Ipo-1;SO;Sod;Sod-1;SODC;superoxide dismutase [Cu-Zn].
• NCBI Gene Id: 20655
• Protein Name: Superoxide dismutase [Cu-Zn]
• Description of Target: Destroys radicals which are normally produced within the cells and which are toxic to biological systems.
• Uniprot ID: P08228
• Protein Size (# AA): Recombinant
• Molecular Weight: 19.8 kDa