SOCS2 Antibody - C-terminal region (ARP63434_P050)

Catalog No: ARP63434_P050

WB Suggested Anti-SOCS2 Antibody
Titration: 1.0 ug/ml
Positive Control: U937 Whole Cell

Lanes:
Lane 1: 50ug Mouse adipose lysate
Primary Antibody Dilution:
1:1000
Secondary Antibody:
Donkey anti-Rabbit-HRP
Secondary Antibody Dilution:
1:10000
Gene Name:
SOCS2
Submitted by:
Libin Liu, Boston University.

Product Info

• Tested Species Reactivity: Human, Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: KQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SOCS2 (ARP63434_P050) antibody is Catalog # AAP63434
• Description:
  View product citations for SOCS2 Antibody - C-terminal region (ARP63434_P050) on CiteAb

Target Info

• Gene Symbol: SOCS2
• Gene Full Name: Suppressor of cytokine signaling 2
• Alias Symbols: CIS2, SSI2, Cish2, SSI-2, SOCS-2, STATI2
• NCBI Gene Id: 8835
• Protein Name: Suppressor of cytokine signaling 2
• Description of Target: This gene encodes a member of the STAT-induced STAT inhibitor (SSI), also known as suppressor of cytokine signaling (SOCS), family. SSI family members are cytokine-inducible negative regulators of cytokine signaling. The expression of this gene can be induced by a subset of cytokines, including erythropoietin, GM-CSF, IL10 and interferon (IFN)-gamma. The protein encoded by this gene is found to interact with the cytoplasmic domain of insulin-like growth factor-1 receptor (IGF1R), and thus is thought to be involved in the regulation of IGF1R mediated cell signaling. Knockout studies in mice also suggested a regulatory role of this gene in IGF-1 related growth control.
• Uniprot ID: O14508
• Protein Accession #: NP_003868
• Nucleotide Accession #: NM_003877
• Protein Size (# AA): 198
• Molecular Weight: 22kDa
• Protein Interactions: Tceb1; CUL5; UBC; FLT3; ARFIP2; TPD52; PLA2G1B; BMI1; SOCS3; LCK; GHR; CCNC; RYBP; PTK2B; RNF7; TCEB2; EPOR; PTK2; PRLR; INSR; IGF1R; SOCS1;