Search Antibody, Protein, and ELISA Kit Solutions

SOCS1 Antibody - middle region (ARP42148_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP42148_P050-FITC Conjugated

ARP42148_P050-HRP Conjugated

ARP42148_P050-Biotin Conjugated

Gene Symbol:
SOCS1
Official Gene Full Name:
Suppressor of cytokine signaling 1
NCBI Gene Id:
8651
Protein Name:
Suppressor of cytokine signaling 1
Swissprot Id:
O15524
Protein Accession #:
NP_003736
Nucleotide Accession #:
NM_003745
Alias Symbols:
CIS1, CISH1, JAB, SOCS-1, SSI-1, SSI1, TIP3
Replacement Item:
This antibody may replace item sc-7006 from Santa Cruz Biotechnology.
Description of Target:
SOCS1 is a member of the STAT-induced STAT inhibitor (SSI), also known as suppressor of cytokine signaling (SOCS), family. SSI family members are cytokine-inducible negative regulators of cytokine signaling. SOCS1 functions downstream of cytokine receptors, and takes part in a negative feedback loop to attenuate cytokine signaling. Knockout studies in mice suggested the role of its gene as a modulator of IFN-gamma action, which is required for normal postnatal growth and survival.
Protein Size (# AA):
211
Molecular Weight:
23kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SOCS1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SOCS1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human SOCS1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Human, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-SOCS1 (ARP42148_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
CSF2RB; TCEB1; ERBB2; ABL1; CYTIP; gag; TP53; JAK2; ATR; ATM; JAK1; INSR; FGFR3; LCK; RASA1; PDCD1; IRS1; ETV6; DAB1; TIRAP; VHL; VAV1; TUBG1; RELA; MAP3K5; CLEC7A; PTPN11; TYK2; IRF3; IFNAR1; TCEB2; ALK; COMMD1; TRIM8; PIK3R2; GHR; IRS2; TEC; NCK1; VAV2;
Blocking Peptide:
For anti-SOCS1 (ARP42148_P050) antibody is Catalog # AAP42148 (Previous Catalog # AAPS11809)
Datasheets/Manuals:
Printable datasheet for anti-SOCS1 (ARP42148_P050) antibody

Product Reviews

Average Rating:
1 review
5 star
1
4 star
0
3 star
0
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

110/04/2017 17:30
  • Overall Experience:
  • Quality:
Product Review: SOCS1 antibody - middle region (ARP42148_P050) in rat liver using Western Blot
1. On a scale of 1-5, how will you rate this antibody? 4.5
2. How many ug of tissue/cell lysate was used to run on gel? 100 ug
3. What species and tissue/cell type was used to run on gel? Rat liver
4. Primary antibody dilution? 1 ug/mL
6. Secondary antibody dilution? Anti-rabbit 1:2000
7. Please share the protocol used for the experiment. Bloking 5% milk, primary antibody overnight 4C, secondary antibody 1 h room temperature
8. Comment on overall experience with the antibody sample.

In my opinion, this antibody covers my expectative properly.
Rat liver

Submitted by Ana Alvarez Mercado, PHD, Experimental Liver Surgery and Liver Transplantation Institut D'Investigacions Biomèdiques August Pi i Sunyer
0
0
Reply
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...