SNX4 Antibody - middle region (ARP88420_P050)

Catalog No: ARP88420_P050

Host: Rabbit
Target Name: SNX4
Sample Tissue: Human Jurkat Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SNX4
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: TQEGNWKETVNETGFQLKADSRLKALNATFRVKNPDKRFTDLKHYSDELQ
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SNX4 (ARP88420_P050) antibody is Catalog # AAP88420

Target Info

• Gene Symbol: SNX4
• Gene Full Name: sorting nexin 4
• Alias Symbols: ATG24B
• NCBI Gene Id: 8723
• Protein Name: sorting nexin-4
• Description of Target: This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein associated with the long isoform of the leptin receptor and with receptor tyrosine kinases for platelet-derived growth factor, insulin, and epidermal growth factor in cell cultures, but its function is unknown. This protein may form oligomeric complexes with family members. Two transcript variants, one protein coding and the other non-protein coding, have been found for this gene.
• Uniprot ID: O95219-2
• Protein Accession #: NP_003785.1
• Nucleotide Accession #: NM_003794.3
• Protein Size (# AA): 305
• Molecular Weight: 33 kDa