SNX27 Antibody - N-terminal region (ARP81595_P050)

Catalog No: ARP81595_P050

Host: Rabbit
Target Name: SNX27
Sample Tissue: Human 293T Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SNX27
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: PSAPHRNGGGGGGGGSGLHCAGNGGGGGGGPRVVRIVKSESGYGFNVRGQ
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SNX27 (ARP81595_P050) antibody is Catalog # AAP81595

Target Info

• Gene Symbol: SNX27
• Gene Full Name: sorting nexin family member 27
• Alias Symbols: MRT1, MY014
• NCBI Gene Id: 81609
• Protein Name: sorting nexin-27
• Description of Target: This gene encodes a member of the sorting nexin family, a diverse group of cytoplasmic and membrane-associated proteins involved in endocytosis of plasma membrane receptors and protein trafficking through these compartments. All members of this protein family contain a phosphoinositide binding domain (PX domain). A highly similar protein in mouse is responsible for the specific recruitment of an isoform of serotonin 5-hydroxytryptamine 4 receptor into early endosomes, suggesting the analogous role for the human protein.
• Uniprot ID: Q96L92
• Protein Accession #: NP_112180.4
• Nucleotide Accession #: NM_030918.5
• Protein Size (# AA): 541
• Molecular Weight: 59 kDa