Search Antibody, Protein, and ELISA Kit Solutions

SNX2 Antibody - middle region (ARP84992_P050)

100 ul
In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Predicted Species Reactivity:
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
sorting nexin 2
NCBI Gene Id:
Protein Name:
sorting nexin-2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
This gene belongs to the sorting nexin family whose members contain the phosphoinositide-binding phox (PX) domain. The encoded protein is a component of the retromer complex which plays a role in protein sorting in the endocytic pathway. This protein may form oligomeric complexes with other family members. Alternate splicing results in multiple transcript variants of this gene. Pseudogenes associated with this gene are located on chromosomes 1 and 7.
Protein Size (# AA):
Molecular Weight:
44 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SNX2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SNX2.
The immunogen is a synthetic peptide directed towards the middle region of human SNX2
Peptide Sequence:
Synthetic peptide located within the following region: REAEAKMMVANKPDKIQQAKNEIREWEAKVQQGERDFEQISKTIRKEVGR
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-SNX2 (ARP84992_P050) antibody is Catalog # AAP84992
Printable datasheet for anti-SNX2 (ARP84992_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...