Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP84992_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

SNX2 Antibody - middle region (ARP84992_P050)

Catalog#: ARP84992_P050
Domestic: within 24 hours delivery | International: 3-5 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SNX2
Purification Affinity purified
Peptide Sequence Synthetic peptide located within the following region: REAEAKMMVANKPDKIQQAKNEIREWEAKVQQGERDFEQISKTIRKEVGR
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-SNX2 (ARP84992_P050) antibody is Catalog # AAP84992
Datasheets/Manuals Printable datasheet for anti-SNX2 (ARP84992_P050) antibody
Gene Symbol SNX2
Official Gene Full Name sorting nexin 2
Alias Symbols TRG-9
NCBI Gene Id 6643
Protein Name sorting nexin-2
Description of Target This gene belongs to the sorting nexin family whose members contain the phosphoinositide-binding phox (PX) domain. The encoded protein is a component of the retromer complex which plays a role in protein sorting in the endocytic pathway. This protein may form oligomeric complexes with other family members. Alternate splicing results in multiple transcript variants of this gene. Pseudogenes associated with this gene are located on chromosomes 1 and 7.
Swissprot Id O60749-2
Protein Accession # NP_001265128.1
Nucleotide Accession # NM_001278199.1
Protein Size (# AA) 402
Molecular Weight 44 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express SNX2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express SNX2.
  1. What is the species homology for "SNX2 Antibody - middle region (ARP84992_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "SNX2 Antibody - middle region (ARP84992_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 days".

  3. What buffer format is "SNX2 Antibody - middle region (ARP84992_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SNX2 Antibody - middle region (ARP84992_P050)"?

    This target may also be called "TRG-9" in publications.

  5. What is the shipping cost for "SNX2 Antibody - middle region (ARP84992_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SNX2 Antibody - middle region (ARP84992_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SNX2 Antibody - middle region (ARP84992_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "44 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SNX2 Antibody - middle region (ARP84992_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "SNX2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SNX2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SNX2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SNX2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SNX2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SNX2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SNX2 Antibody - middle region (ARP84992_P050)
Your Rating