Protein on Demand™ SNRPB Recombinant Protein (Western European hedgehog) (OPCA331871)

Datasheets/Manuals	Printable datasheet for OPCA331871

Product Info
Predicted Species Reactivity	Western European hedgehog
Product Format	Liquid
Application	WB, ELISA
Reconstitution and Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Purity	Greater than 85% as determined by SDS-PAGE.
Protein Sequence	MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGPPPPGLRPPRP
Storage Buffer	Tris-based buffer,50% glycerol
Protein Range	1-240

Alias Symbols	SmB', SNRB', Sm-B', SNRPB', snRNP-B'
NCBI Gene Id	103113472
Protein Name	small nuclear ribonucleoprotein-associated protein B'
Uniprot ID	Q9TU67
Protein Size (# AA)	240