Search Antibody, Protein, and ELISA Kit Solutions

SNRNP48 Antibody - C-terminal region (ARP95785_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
SNRNP48
Official Gene Full Name:
small nuclear ribonucleoprotein 48 (U11/U12)
NCBI Gene Id:
67797
Protein Name:
U11/U12 small nuclear ribonucleoprotein 48 kDa protein
Swissprot Id:
Q9D361
Protein Accession #:
NP_080658.2
Nucleotide Accession #:
NM_026382.2
Alias Symbols:
C6orf151, 1110050F08Rik, 6530403A03Rik
Description of Target:
Likely involved in U12-type 5' splice site recognition.
Protein Size (# AA):
337
Molecular Weight:
37 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SNRNP48.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SNRNP48.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of mouse SNRNP48
Predicted Species Reactivity:
Mouse
Tested Species Reactivity:
Mouse
Peptide Sequence:
Synthetic peptide located within the following region: YLDVESSRHRRARSRSPHKRKRNKDKSSESRRRKERDGERHHSHKRRKQK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-SNRNP48 (ARP95785_P050) antibody is Catalog # AAP95785
Datasheets/Manuals:
Printable datasheet for anti-SNRNP48 (ARP95785_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...