SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP57950_P050
Price: $0.00
SKU
ARP57950_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-SNF8 (ARP57950_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SNF8
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
Peptide SequenceSynthetic peptide located within the following region: DHTVVLQLAEKNGYVTVSEIKASLKWETERARQVLEHLLKEGLAWLDLQA
Concentration0.5 mg/ml
Blocking PeptideFor anti-SNF8 (ARP57950_P050) antibody is Catalog # AAP57950 (Previous Catalog # AAPP32361)
Gene SymbolSNF8
Gene Full NameSNF8, ESCRT-II complex subunit, homolog (S. cerevisiae)
Alias SymbolsDot3, EAP30, VPS22
NCBI Gene Id11267
Protein NameVacuolar-sorting protein SNF8
Description of TargetELL encodes an RNA polymerase II transcription factor that undergoes frequent translocation in acute myeloid leukemia (AML). In addition to its elongation activity, ELL contains a novel type of RNA polymerase II interaction domain that is capable of repressing polymerase activity in promoter-specific transcription. EAP30 is a subunit of the ELL complex. EAP30 can interact with ELL and derepress ELL's inhibitory activity in vitro.SNF8, VPS25 (MIM 610907), and VPS36 (MIM 610903) form ESCRT-II (endosomal sorting complex required for transport II), a complex involved in endocytosis of ubiquitinated membrane proteins. SNF8, VPS25, and VPS36 are also associated in a multiprotein complex with RNA polymerase II elongation factor.
Uniprot IDQ96H20
Protein Accession #NP_009172
Nucleotide Accession #NM_007241
Protein Size (# AA)258
Molecular Weight29kDa
Protein InteractionsGOLGA2; VPS25; TRIM54; VAC14; UBC; BCAT1; SUV39H2; ACBD3; DUS3L; WDR12; PRMT6; RPUSD2; KDM1A; EFTUD2; TTC1; HARS; GTF2F1; GTF2E1; ELL; RBP1; MCM2; ADORA1; METTL14; NUDCD3; RILP; VPS36; CHMP6; VPS28; SNF8; TSG101; VPS20; NIF3L1; DVL2;
  1. What is the species homology for "SNF8 Antibody - middle region (ARP57950_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "SNF8 Antibody - middle region (ARP57950_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SNF8 Antibody - middle region (ARP57950_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SNF8 Antibody - middle region (ARP57950_P050)"?

    This target may also be called "Dot3, EAP30, VPS22" in publications.

  5. What is the shipping cost for "SNF8 Antibody - middle region (ARP57950_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SNF8 Antibody - middle region (ARP57950_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SNF8 Antibody - middle region (ARP57950_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "29kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SNF8 Antibody - middle region (ARP57950_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SNF8"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SNF8"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SNF8"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SNF8"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SNF8"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SNF8"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SNF8 Antibody - middle region (ARP57950_P050)
Your Rating
We found other products you might like!